Recombinant Human Carbonic Anhydrase 1, CA1 (C-6His)

Contact us
Catalog number: C107
Price: 869 €
Supplier: DL elisas
Product name: Recombinant Human Carbonic Anhydrase 1, CA1 (C-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 110€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Carbonic Anhydrase 1 is produced by our E, coli expression system and the target gene encoding Ala2-Phe261 is expressed with a 6His tag at the C-terminus
Molecular Weight: 29, 93 kD
UniProt number: P00915
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASFLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CA1 (C-6His), Carbonic Anhydrase 1
Short name: CA1 (C-6His), Recombinant Carbonic Anhydrase 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CA1 (C-6His), sapiens Carbonic Anhydrase 1, recombinant H
Alternative technique: rec
Identity: 1368
Gene: CA1 | More about : CA1
Long gene name: carbonic anhydrase 1
Synonyms gene name: carbonic anhydrase I
Synonyms: Car1
Locus: 8q21, 2
Discovery year: 1986-01-01
GenBank acession: M33987
Entrez gene record: 759
Pubmed identfication: 1916821
RefSeq identity: NM_001738
Classification: Carbonic anhydrases
Havana BLAST/BLAT: OTTHUMG00000164941

Related Products :

C107 Recombinant Human Carbonic Anhydrase 1, CA1 (C-6His) 10 µg 110 € novo human
MBS624510 CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623542 CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
abx573755 Anti-Human Carbonic Anhydrase I (CA1) ELISA Kit 96 tests 731 € abbex human
MBS244737 Goat Polyclonal to Human CA1 / Carbonic Anhydrase I Antibody 50ug 597 € MBS Polyclonals_1 human
DL-CA1-Hu Human Carbonic Anhydrase I CA1 ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bde7a02dd48 Mouse Monoclonal [clone 9D6D7] (IgG1) to Human CA1 / Carbonic Anhydrase I Antibody 0.05 ml 597 € MBS mono human
MBS247207 PAb (IgG) to Human CA1 / Carbonic Anhydrase I Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bdc922439cc Anti- Carbonic Anhydrase I (CA1) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdcb1827dd2 Anti- Carbonic Anhydrase I (CA1) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdcb186cb4d Anti- Carbonic Anhydrase I (CA1) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdcc3db5703 Anti- Carbonic Anhydrase I (CA1) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcc3e2df36 Anti- Carbonic Anhydrase I (CA1) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdcfbf11df3 Anti- Carbonic Anhydrase I (CA1) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd41c0d223 Anti- Carbonic Anhydrase I (CA1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd9d8cf2e9 Anti- Carbonic Anhydrase I (CA1) Antibody 100ug 520 € MBS Polyclonals human
abx573416 Anti-Mouse Carbonic Anhydrase I (CA1) ELISA Kit 96 tests 746 € abbex mouse
GENTAUR-58bdbbd5556b7 Bovine Carbonic anhydrase 1 (CA1) 100ug 1768 € MBS Recombinant Proteins bovine
GENTAUR-58bdbbd5939ab Bovine Carbonic anhydrase 1 (CA1) 1000ug 1768 € MBS Recombinant Proteins bovine
GENTAUR-58bdbbd5f3eb8 Bovine Carbonic anhydrase 1 (CA1) 100ug 2282 € MBS Recombinant Proteins bovine
GENTAUR-58bdbbd66b84c Bovine Carbonic anhydrase 1 (CA1) 1000ug 2282 € MBS Recombinant Proteins bovine
R31859 Carbonic Anhydrase I Antibody / CA1 0.1mg 406 € NJS poly human
EKU02916 Carbonic Anhydrase I (CA1) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
GENTAUR-58b898cf365bd Chionodraco hamatus Carbonic anhydrase 1 (ca1) 100ug 1768 € MBS Recombinant Proteins human
GENTAUR-58b898cf7eeb2 Chionodraco hamatus Carbonic anhydrase 1 (ca1) 1000ug 1768 € MBS Recombinant Proteins human
GENTAUR-58b898cfbec0d Chionodraco hamatus Carbonic anhydrase 1 (ca1) 100ug 2277 € MBS Recombinant Proteins human
GENTAUR-58b898d0301f2 Chionodraco hamatus Carbonic anhydrase 1 (ca1) 1000ug 2277 € MBS Recombinant Proteins human
AE52813HO-48 ELISA test for Horse Carbonic anhydrase 1 (CA1) 1x plate of 48 wells 402 € abebio horse
AE52813HO-96 Horse Carbonic anhydrase 1 (CA1) ELISA Kit 1x plate of 96 wells 671 € abebio horse
DL-CA1-Mu Mouse Carbonic Anhydrase I CA1 ELISA Kit 96T 869 € DL elisas mouse