Recombinant Human BH3-Interacting Domain Death Agonist, BID

Contact us
Catalog number: C106
Price: 904 €
Supplier: DL elisas
Product name: Recombinant Human BH3-Interacting Domain Death Agonist, BID
Quantity: 96T
Other quantities: 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human BH3-Interacting Domain Death Agonist is produced by our E, coli expression system and the target gene encoding Met1-Asp195 is expressed
Molecular Weight: 21, 99 kD
UniProt number: P55957
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 100 mM KCl, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BID, BH3-Interacting Domain Death Agonist
Short name: BID, Recombinant BH3-Interacting Domain Death Agonist
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BH3 interacting domain death a this GO nist, sapiens BH3-Interacting Domain Death Agonist, recombinant H
Alternative technique: rec
Alternative to gene target: BID and IDBG-1050 and ENSG00000015475 and 101929618, BID and IDBG-641320 and ENSBTAG00000013988 and 510373, Bid and IDBG-184076 and ENSMUSG00000004446 and 12122, FP497, Plasma membranes, this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0005123 and death receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0006626 and protein targeting to mitochondrion and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0007420 and brain development and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0016020 and membrane and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032355 and response to estradiol and biological process this GO :0032459 and regulation of protein oli this GO merization and biological process this GO :0032461 and positive regulation of protein oli this GO merization and biological process this GO :0032464 and positive regulation of protein homooli this GO merization and biological process this GO :0032592 and integral component of mitochondrial membrane and cellular component this GO :0034349 and glial cell apoptotic process and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0090150 and establishment of protein localization to membrane and biological process this GO :0090200 and positive regulation of release of cytochrome c from mitochondria and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :1900740 and positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process this GO :1901030 and positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and biological process this GO :1902108 and regulation of mitochondrial membrane permeability involved in apoptotic process and biological process this GO :2000045 and regulation of G1/S transition of mitotic cell cycle and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005123 : death receptor binding, this GO :0005123 : death receptor binding and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, 637, 782484, BH3 interacting domain death a this GO nist
Identity: 1050
Gene: BID | More about : BID
Long gene name: BH3 interacting domain death agonist
Locus: 22q11, 21
Discovery year: 1998-04-20
GenBank acession: AF042083
Entrez gene record: 637
Pubmed identfication: 8918887 9721221
RefSeq identity: NM_197966
Classification: Endogenous ligands BCL2 homology region 3 (BH3) only
Havana BLAST/BLAT: OTTHUMG00000150087

Related Products :

MBS623726 Bid, phosphorylated (Ser65) (BH3-interacting Domain Death Agonist, p22 BID) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623849 BID, phosphorylated (Ser61) (Bcl-2 Interacting Domain, BH3 Interacting Domain Death Agonist) Antibody 100ug 674 € MBS Polyclonals_1 human
C106 Recombinant Human BH3-Interacting Domain Death Agonist, BID 1 mg 2283 € novo human
MBS280041 Anti-Human BH3 Interacting Domain Death Agonist (BID) PAb 100ug 536 € MBS Polyclonals_1 human
GWB-6665C1 BH3 Interacting Domain Death Agonist (BID) Rabbit antibody to or anti-Human Polyclonal antibody 1 tube 648 € genways human
GWB-48E3DB BH3 Interacting Domain Death Agonist (BID) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 x 1 vial 648 € genways human
DL-Bid-Hu Human BH3 Interacting Domain Death Agonist Bid ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bdc1882919c Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdc38599118 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdc386736bc Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdc6ffc5294 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc70035abb Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc71f35652 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcbadaa7f9 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdcfe28e149 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 50ug 337 € MBS Polyclonals human
GENTAUR-58bdcfe30f662 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 420 € MBS Polyclonals human
GENTAUR-58bdd7e490dbe Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdda01b3961 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddd52a7104 Anti- BH3 Interacting Domain Death Agonist (Bid) Antibody 100ug 520 € MBS Polyclonals human
EKU02715 BH3 Interacting Domain Death Agonist (Bid) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU02716 BH3 Interacting Domain Death Agonist (Bid) ELISA kit 1 plate of 96 wells 685 € Biomatik ELISA kits human
EKU02717 BH3 Interacting Domain Death Agonist (Bid) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
MBS613724 BID, Cleavage Site aa59/60 (BH3 Interacting Domain Death Agonist) Antibody 10 Blots 685 € MBS Polyclonals_1 human
MBS615956 BID, Full Length (BH3 Interacting Domain Death Agonist) Antibody 100ul 564 € MBS Polyclonals_1 human
DL-Bid-Mu Mouse BH3 Interacting Domain Death Agonist Bid ELISA Kit 96T 788 € DL elisas mouse
GENTAUR-58bdbebc5a2cf Pig BH3-interacting domain death agonist (BID) 100ug 1591 € MBS Recombinant Proteins pig
GENTAUR-58bdbebccd283 Pig BH3-interacting domain death agonist (BID) 1000ug 1591 € MBS Recombinant Proteins pig
GENTAUR-58bdbebd2fb28 Pig BH3-interacting domain death agonist (BID) 100ug 2105 € MBS Recombinant Proteins pig
GENTAUR-58bdbebd8ef40 Pig BH3-interacting domain death agonist (BID) 1000ug 2105 € MBS Recombinant Proteins pig
DL-Bid-Ra Rat BH3 Interacting Domain Death Agonist Bid ELISA Kit 96T 904 € DL elisas rat