Recombinant Rabbit Tumor Necrosis Factor α, TNF-α

Contact us
Catalog number: C082
Price: 444 €
Supplier: Chondrocytes and collagens
Product name: Recombinant Rabbit Tumor Necrosis Factor α, TNF-α
Quantity: 1 assay kit or ELISA kit
Other quantities: 10 µg 168€ 50 µg 405€ 500 µg 1613€
Related search:

More details :

Reacts with: Rabbit
Source: proteins, Recombinants or rec
Description: Recombinant Rabbit Tumor Necrosis Factor alpha is produced by our E, coli expression system and the target gene encoding Val77-Leu235 is expressed
Molecular Weight: 17, 59 kD
UniProt number: P04924
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 300 mM sodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
About: Anti-human, Rabbit antibodies are very stable and can be stored for several days at room temperature, anti mouse antibodies to highly immunogenic selected peptide sequences are", monoclonal like", novo adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies, since the epitope to which they are directed is less than 35 amino acids long, Rabbits are used for polyclonal antibody production by novo
Latin name: Oryctolagus cuniculus
Group: recombinants
Gene: It is produced chiefly by activated , TNFb or TNF beta also bin on TNF receptors for Th1 activation, although it can be produced by many other cell types such as , and , or ,  ,  ,  ,  ,  ,  ,  , (TNFa, CD4+ lymphocytes, NK cells, TNF&alpha, Tumor necrosis factor , acute phase reaction, and is one of the cytokines that make up the , cachectin) is a cell signaling protein (cytokine) involved in systemic inflammation , cachexin, eosinophils, macrophages, mast cells, neurons, neutrophils, tumor necrosis factor alpha | More about : It is produced chiefly by activated , TNFb or TNF beta also bin on TNF receptors for Th1 activation, although it can be produced by many other cell types such as , and , or ,  ,  ,  ,  ,  ,  ,  , (TNFa, CD4+ lymphocytes, NK cells, TNF&alpha, Tumor necrosis factor , acute phase reaction, and is one of the cytokines that make up the , cachectin) is a cell signaling protein (cytokine) involved in systemic inflammation , cachexin, eosinophils, macrophages, mast cells, neurons, neutrophils, tumor necrosis factor alpha
Gene target: TNF-&alpha, Tumor Necrosis Factor &alpha
Short name: TNF-&alpha, Recombinant Rabbit Tumor Necrosis Factor &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Rabbits, Rabbit
Alternative name: tumor necrosis factor-&alpha, recombinant production species: rabbit Tumor Necrosis Factor &alpha
Alternative technique: rec
Alternative to gene target: DIF and TNF-alpha and TNFA and TNFSF2, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045994 and positive regulation of translational initiation by iron and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050796 and regulation of insulin secretion and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050901 and leukocyte tethering or rolling and biological process this GO :0050966 and detection of mechanical stimulus involved in sensory perception of pain and biological process this GO :0050995 and negative regulation of lipid catabolic process and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051222 and positive regulation of protein transport and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051533 and positive regulation of NFAT protein import into nucleus and biological process this GO :0051798 and positive regulation of hair follicle development and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055037 and recycling endosome and cellular component this GO :0060557 and positive regulation of vitamin D biosynthetic process and biological process this GO :0060559 and positive regulation of calcidiol 1-monooxygenase activity and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060693 and regulation of branching involved in salivary gland morphogenesis and biological process this GO :0061048 and negative regulation of branching involved in lung morphogenesis and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :0071316 and cellular response to nicotine and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071677 and positive regulation of mononuclear cell migration and biological process this GO :0071803 and positive regulation of podosome assembly and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097527 and necroptotic signaling pathway and biological process this GO :1990268 and response to this GO ld nanoparticle and biological process this GO :2000010 and positive regulation of protein localization to cell surface and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process this GO :2000377 and regulation of reactive oxygen species metabolic process and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, Extracellular, TNF and IDBG-300259 and ENSG00000232810 and 7124, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, this GO :0000060 and protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044212 : transcription regulatory region DNA binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0044212 : transcription regulatory region DNA binding, transcription regulatory region DNA binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001775 and cell activation and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001891 and pha this GO cytic cup and cellular component this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002020 and protease binding and molecular function this GO :0002037 and negative regulation of L-glutamate transport and biological process this GO :0002439 and chronic inflammatory response to antigenic stimulus and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0002876 and positive regulation of chronic inflammatory response to antigenic stimulus and biological process this GO :0002925 and positive regulation of humoral immune response mediated by circulating immunoglobulin and biological process this GO :0003009 and skeletal muscle contraction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006927 and transformed cell apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007254 and JNK cascade and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009651 and response to salt stress and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014823 and response to activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030730 and sequestering of triglyceride and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031622 and positive regulation of fever generation and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032741 and positive regulation of interleukin-18 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032800 and receptor biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034116 and positive regulation of heterotypic cell-cell adhesion and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042346 and positive regulation of NF-kappaB import into nucleus and biological process this GO :0042493 and response to drug and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043242 and negative regulation of protein complex disassembly and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0044130 and negative regulation of growth of symbiont in host and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045080 and positive regulation of chemokine biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045123 and cellular extravasation and biological process this GO :0045416 and positive regulation of interleukin-8 biosynthetic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045760 and positive regulation of action potential and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045892 and negative regulation of transcription, tumor necrosis factor

Related Products :

MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
C082 Recombinant Rabbit Tumor Necrosis Factor α, TNF-α 10 µg 168 € novo human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
TNFA15-R-10 Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 10 μg 260 € adi human
TNFA16-R-10 Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha Variant (TNF-alpha variant, 151-aa), biologically active 10 μg 260 € adi human
TNFA35-R-5 Recombinant (E.Coli) purified mouse Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
TNFA36-R-5 Recombinant (E.Coli) purified porcine Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
TNFA25-R-5 Recombinant (E.Coli) purified rat Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
C036 Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant 10 µg 151 € novo human
GWB-36AB53 Tumor Necrosis Factor Alpha (TNF a) recombinant Mouse 1 x 1 vial 579 € genways mouse
GWB-F465E2 Tumor Necrosis Factor Alpha (TNF a) recombinant Rat 1 vial 579 € genways rat
KT-57169 Rabbit Tumor Necrosis Factor ? (TNF?) ELISA kit 96 well plate 1091 € Kamiya human
GWB-335C43 Tumor Necrosis Factor (TNF) Rabbit antibody to or anti-Bovine Polyclonal antibody 1 x 1 vial 602 € genways bovine
TNFR25-R-20 Recombinant purified human TNF Receptor 2 (TNFR2/TNF-RII, Etannercept/TNF-R75, p75TNFR) protein (E.Coli, His-tag) 10 μg 333 € adi human
GWB-2B0C00 Tumor Necrosis Factor-a (TNF-a) (recombinant) Human 1 x 1 vial 579 € genways human
GWB-BE66BF Tumor Necrosis Factor-b (TNF-b) (recombinant) Human AG 1 vial 579 € genways human
E-EL-C0007 Canine TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0215 Chicken TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit 96T 497 € elabsciences human
AE13963CH Chicken Tumor necrosis factor α (TNF-α) ELISA Kit 96 wells plate 739 € ab-elisa elisas human
AE13963CH-96 Chicken Tumor necrosis factor α (TNF-α) ELISA Kit 1x plate of 96 wells 587 € abebio human
AE13963CH-48 ELISA test for Chicken Tumor necrosis factor α (TNF-α) 1x plate of 48 wells 360 € abebio human
AE13962FI-48 ELISA test for Fish Tumor Necrosis Factor α (TNF-α) 1x plate of 48 wells 402 € abebio human
AE13958RA-48 ELISA test for Rat Tumor necrosis factor α (TNF-α) 1x plate of 48 wells 402 € abebio human
AE13962FI Fish Tumor Necrosis Factor α (TNF-α) ELISA Kit 96 wells plate 840 € ab-elisa elisas human
AE13962FI-96 Fish Tumor Necrosis Factor α (TNF-α) ELISA Kit 1x plate of 96 wells 671 € abebio human
TNFA13-A Goat Anti-Human Tumor Necrosis Factor-Alpha (TNF-alpha) IgG #2, aff. Pure (neutralzing) 100 μL 565 € adi human
6801 Human Tumor Necrosis Factor Alpha (TNF-alpha) Detection Assay Kit 1 assay kit or ELISA kit 444 € Chondrocytes and collagens human