Recombinant Human Pro-Brain-Derived Neurotrophic Factor, pro-BDNF

Contact us
Catalog number: C077
Price: 382 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Pro-Brain-Derived Neurotrophic Factor, pro-BDNF
Quantity: 50ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human pro-Brain-Derived Neurotrophic Factor is produced by our E, coli expression system and the target gene encoding Ala19-Arg247 is expressed
Molecular Weight: 52 kD
UniProt number: P23560
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 250 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: pro-BDNF, Pro-Brain-Derived Neurotrophic Factor
Short name: pro-BDNF, Recombinant Pro-Brain-Derived Neurotrophic Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: L-proline-brain-derived neurotrophic factor, sapiens L-proline-Brain-Derived Neurotrophic Factor, recombinant H
Alternative technique: rec
Alternative to gene target: ANON2 and BULN2, BDNF and IDBG-36817 and ENSG00000176697 and 627, BDNF and IDBG-636102 and ENSBTAG00000008134 and 617701, Bdnf and IDBG-195506 and ENSMUSG00000048482 and 12064, Extracellular, GABAergic and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033189 and response to vitamin A and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0035864 and response to potassium ion and biological process this GO :0042490 and mechanoreceptor differentiation and biological process this GO :0042493 and response to drug and biological process this GO :0042596 and fear response and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043195 and terminal bouton and cellular component this GO :0043204 and perikaryon and cellular component this GO :0043523 and regulation of neuron apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045843 and negative regulation of striated muscle tissue development and biological process this GO :0046668 and regulation of retinal cell programmed cell death and biological process this GO :0048167 and regulation of synaptic plasticity and biological process this GO :0048169 and regulation of long-term neuronal synaptic plasticity and biological process this GO :0048170 and positive regulation of long-term neuronal synaptic plasticity and biological process this GO :0048172 and regulation of short-term neuronal synaptic plasticity and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048675 and axon extension and biological process this GO :0048839 and inner ear development and biological process this GO :0050890 and cognition and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0051965 and positive regulation of synapse assembly and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0060079 and regulation of excitatory postsynaptic membrane potential and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0061193 and taste bud development and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071874 and cellular response to norepinephrine stimulus and biological process this GO :0072347 and response to anesthetic and biological process this GO :0097484 and dendrite extension and biological process this GO :1901215 and negative regulation of neuron death and biological process this GO :1902065 and response to L-glutamate and biological process this GO :1990089 and response to nerve growth factor and biological process this GO :1990090 and cellular response to nerve growth factor stimulus and biological process this GO :1990138 and neuron projection extension and biological process, NADH to ubiquinone and biological process this GO :0007214 and gamma-aminobutyric acid signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0007406 and negative regulation of neuroblast proliferation and biological process this GO :0007411 and axon guidance and biological process this GO :0007412 and axon target recognition and biological process this GO :0007611 and learning or memory and biological process this GO :0007612 and learning and biological process this GO :0007623 and circadian rhythm and biological process this GO :0007631 and feeding behavior and biological process this GO :0008021 and synaptic vesicle and cellular component this GO :0008038 and neuron recognition and biological process this GO :0008083 and growth factor activity and molecular function this GO :0009416 and response to light stimulus and biological process this GO :0009642 and response to light intensity and biological process this GO :0009725 and response to hormone and biological process this GO :0010996 and response to auditory stimulus and biological process this GO :0014047 and glutamate secretion and biological process this GO :0014076 and response to fluoxetine and biological process this GO :0014823 and response to activity and biological process this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0016358 and dendrite development and biological process this GO :0019222 and regulation of metabolic process and biological process this GO :0021675 and nerve development and biological process this GO :0030061 and mitochondrial crista and cellular component this GO :0030424 and axon and cellular component this GO :0030425 and dendrite and cellular component this GO :0030516 and regulation of axon extension and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0032094 and response to food and biological process this GO :0032229 and negative regulation of synaptic transmission, growth factor activity, this GO :0001657 and ureteric bud development and biological process this GO :0001662 and behavioral fear response and biological process this GO :0001666 and response to hypoxia and biological process this GO :0002544 and chronic inflammatory response and biological process this GO :0005102 and receptor binding and molecular function this GO :0005169 and neurotrophin TRKB receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006120 and mitochondrial electron transport, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005169 : neurotrophin TRKB receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity, this GO :0005169 : neurotrophin TRKB receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, brain-derived neurotrophic factor
Identity: 1033
Gene: BDNF | More about : BDNF
Long gene name: brain derived neurotrophic factor
Synonyms name: neurotrophin
Locus: 11p14, 1
Discovery year: 1991-01-15
GenBank acession: AB038670
Entrez gene record: 627
Pubmed identfication: 2236018 1889806 17942328 17493809
RefSeq identity: NM_170735
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000178797

Related Products :

C077 Recombinant Human Pro-Brain-Derived Neurotrophic Factor, pro-BDNF 500 µg 1613 € novo human
DEVAS1724 BDNF (Brain Derived Neurotrophic Factor), Clone: mxsghk-BDNF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
MBS612853 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) 100ul 652 € MBS Polyclonals_1 human
MBS613517 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) 50ug 652 € MBS Polyclonals_1 human
MBS618177 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) Antibody 100ul 652 € MBS Polyclonals_1 human
SP-101818-1 Brain Derived Basic Fibroblast Growth Factor (1-24) (AA: Pro-Ala-Leu-Pro-Glu-Asp-Gly-Gly-Ser-Gly-Ala-Phe-Pro-Pro-Gly-His-Phe-Lys-Asp-Pro-Lys-Arg-Leu-Tyr) (MW: 2553.86) 1 mg 260 € adi human
BDNF11-R Recombinant (E.Coli) Human Brain Derived Neurotrophic Factor (BDNF) Protein 5 μg 550 € adi human
C076 Recombinant Human Brain-Derived Neurotrophic Factor, BDNF 50 µg 496 € novo human
DL-BDNF-Hu Human Brain Derived Neurotrophic Factor BDNF ELISA Kit 96T 602 € DL elisas human
BDNF11-M Monoclonal Anti-Human Brain Derived Neurotrophic Factor (BDNF) 100 μg 565 € adi human
BDNF11-C Purified Human Brain Derived Neurotrophic Factor (BDNF) Protein Control for Western 100 μL 333 € adi human
GENTAUR-58bd816671a3f Ailuropoda melanoleuca Brain-derived neurotrophic factor (BDNF) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd8166e2bb5 Ailuropoda melanoleuca Brain-derived neurotrophic factor (BDNF) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd816751e07 Ailuropoda melanoleuca Brain-derived neurotrophic factor (BDNF) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bd8167af6a7 Ailuropoda melanoleuca Brain-derived neurotrophic factor (BDNF) 1000ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bdc1f9e4f1d Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 404 € MBS Polyclonals human
GENTAUR-58bdc1fa5cda9 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc2fe52155 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4efc4aa4 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4f03436a Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc6dc6b8d8 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 343 € MBS Polyclonals human
GENTAUR-58bdc6dcce5c3 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdc94e22c42 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58bdc94e7214e Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58bdca51b806f Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca521be12 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcc75518dc Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcc75c2467 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcfe36372f Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcfe3ddd71 Anti- Brain Derived Neurotrophic Factor (BDNF) Antibody 50ug 382 € MBS Polyclonals human