Recombinant Human Interleukin-17F, IL-17F

Contact us
Catalog number: C030
Price: 587 €
Supplier: acr
Product name: Recombinant Human Interleukin-17F, IL-17F
Quantity: 0,4 ml
Other quantities: 1 mg 2283€ 10 µg 168€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-17F is produced by our E, coli expression system and the target gene encoding Arg31-Gln163 is expressed
Molecular Weight: 1 kD, 30
UniProt number: Q96PD4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IL-17F, Interleukin-17F
Short name: IL-17F, Recombinant Interleukin-17F
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Interleukin-17F, sapiens Interleukin-17F, recombinant H
Alternative technique: rec
Identity: 16404
Gene: IL17F | More about : IL17F
Long gene name: interleukin 17F
Synonyms: IL-17F ML-1 ML1
Locus: 6p12, 2
Discovery year: 2002-03-18
GenBank acession: AF384857
Entrez gene record: 112744
Pubmed identfication: 11591732 11591768
RefSeq identity: NM_052872
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000014845
Locus Specific Databases: LRG_356

Related Products :

CS27 Recombinant Human Interleukin-17F, IL-17F (Human Cells) 10 µg 156 € novo human
C030 Recombinant Human Interleukin-17F, IL-17F 500 µg 1613 € novo human
CA22 Recombinant Human Interleukin-17F, IL-17F (C-6His) 50 µg 369 € novo human
CC11 Recombinant Mouse Interleukin-17F, IL-17F (C-6His) 500 µg 1613 € novo mouse
MBS619613 Interleukin 17F (IL-17F) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS620833 Interleukin 17F (IL-17F) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS622149 Interleukin 17F (IL-17F) (Biotin) Antibody 50ug 464 € MBS Polyclonals_1 human
CI60 Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His) 1 mg 2486 € novo human
GWB-4E5CCA Recombinant Human Interleukin-17F bulk Ask price € genways bulk human
GWB-573E9B Recombinant Mouse Interleukin-17F bulk Ask price € genways bulk mouse
GWB-2A1DB4 Recombinant Rat Interleukin-17F bulk Ask price € genways bulk rat
MBS222761 Anti-HUMAN INTERLEUKIN-17F 100ug 636 € MBS Polyclonals_1 human
abx574442 Anti-Human Interleukin 17F (IL17F) ELISA Kit 96 tests 688 € abbex human
DL-IL17F-Hu Human Interleukin 17F IL17F ELISA Kit 96T 788 € DL elisas human
AR51039PU-N anti-Interleukin-17F / IL17F (31-163, His-tag) Antibody 0,5 mg 1109 € acr human
AR51039PU-S anti-Interleukin-17F / IL17F (31-163, His-tag) Antibody 0,1 mg 485 € acr human
AM31270AF-N anti-Interleukin-17F / IL17F Antibody 0,5 mg 717 € acr human
AM31324AF-N anti-Interleukin-17F / IL17F Antibody 1 mg 1196 € acr human
AM31346BT-N anti-Interleukin-17F / IL17F Antibody 0,1 mg 717 € acr human
AM33382AF-N anti-Interleukin-17F / IL17F Antibody 0,5 mg 717 € acr human
AM33382PU-N anti-Interleukin-17F / IL17F Antibody 2 ml/200Tests 413 € acr human
AR31085PU-N anti-Interleukin-17F / IL17F Antibody 20 Вµg 384 € acr human
AR31085PU-S anti-Interleukin-17F / IL17F Antibody 5 Вµg 253 € acr human
GENTAUR-58bdc498b3e90 Anti- Interleukin 17F (IL17F) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc499149ea Anti- Interleukin 17F (IL17F) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc65b44a41 Anti- Interleukin 17F (IL17F) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd9916183b Anti- Interleukin 17F (IL17F) Antibody 100ug 542 € MBS Polyclonals human
PA241 anti-Interleukin-17F / IL17F Antibody 5 Вµg 253 € acr human
PA241X anti-Interleukin-17F / IL17F Antibody 25 Вµg 384 € acr human
AP52188PU-N anti-Interleukin-17F / IL17F (N-term) Antibody 0,4 ml 587 € acr human