Recombinant Human Granulocyte Colony-Stimulating Factor, G-CSF

Contact us
Catalog number: C002
Price: 1110 €
Supplier: genways
Product name: Recombinant Human Granulocyte Colony-Stimulating Factor, G-CSF
Quantity: 1 x 1 vial
Other quantities: 1 mg 1836€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Colonies can be formed by stimulating factors or recombinant GM-CSF and CSFs activity expressed in Units compared to a standard
Molecular Weight: 18, 8 kD
UniProt number: P09919-2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 0, 150 mM sodium chloride, 5% Mannitol, pH 4, 004% Tween 80, 2 um filtered solution of 10 mM HAc-NaAc, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CSF3 | More about : CSF3
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: G-CSF, Granulocyte Colony-Stimulating Factor
Short name: G-CSF, Recombinant Granulocyte Colony-Stimulating Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: G-CSF, sapiens Granulocyte Colony-Stimulating Factor, recombinant H
Alternative technique: rec
Identity: 2438
Long gene name: colony stimulating factor 3
Synonyms gene: GCSF G-CSF C17orf33
Synonyms gene name: chromosome 17 open reading frame 33 colony stimulating factor 3 (granulocyte)
Synonyms: MGC45931
Synonyms name: granulocyte colony stimulating factor pluripoietin filgrastim lenograstim
Locus: 17q21, 1
Discovery year: 2001-06-22
Entrez gene record: 1440
Pubmed identfication: 3499671 3501046
RefSeq identity: NM_172220
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000133247

Related Products :

C002 Recombinant Human Granulocyte Colony-Stimulating Factor, G-CSF 50 µg 496 € novo human
CB75 Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1 50 µg 496 € novo mouse
CB53 Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1(C-6His) 10 µg 202 € novo mouse
GWB-B5A726 antibody to or anti- Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Human -biotin conjugated antibody 1 vial 602 € genways human
GWB-8AF7B9 antibody to or anti-Human Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) antibody 1 vial 667 € genways human
AE63078HU-48 ELISA test for Human Anti-Granulocyte-Macrophage Colony Stimulating Factor antibody (GM-CSF) Ab 1x plate of 48 wells 352 € abebio human
DEVAS1726 Granulocyte Colony Stimulating Factor (G-CSF), Clone: mxsghk-GCSF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
YSRTMCA1689F Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: BVD2-2C11, Rat Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1689PE Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: BVD2-2C11, Rat Mouse Monoclonal antibody-Human, RPE; flow vial Ask price € accurate-monoclonals human
MAS575p Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: MG.72, Mouse Monoclonal antibody-Human; ELISA/WB/IA 200ug Ask price € accurate-monoclonals human
DEVAS1725 Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: mxsghk-GMCSF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
AE63078HU Human Anti-Granulocyte-Macrophage Colony Stimulating Factor antibody (GM-CSF) Ab ELISA Kit 48 wells plate 455 € ab-elisa elisas human
AE63078HU-96 Human Anti-Granulocyte-Macrophage Colony Stimulating Factor antibody (GM-CSF) Ab ELISA Kit 1x plate of 96 wells 570 € abebio human
GWB-E2D12F antibody to or anti- Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) antibody 1 vial 521 € genways human
YV0341-01 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 17.2, Mouse Monoclonal antibody-Bovine 0.1 mg 354 € accurate-monoclonals bovine
YV0341-05 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 17.2, Mouse Monoclonal antibody-Bovine 0.5 mg Ask price € accurate-monoclonals bovine
YV0342-01 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 20.1, Mouse Monoclonal antibody-Bovine 0.1 mg 354 € accurate-monoclonals bovine
YV0342-05 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 20.1, Mouse Monoclonal antibody-Bovine 0.5 mg Ask price € accurate-monoclonals bovine
E-EL-C0217 Canine GM-CSF (Granulocyte Macrophage Colony Stimulating Factor) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0665 Chicken GM-CSF Ab (Anti-Granulocyte Macrophage Colony Stimulating Factor Antibody) ELISA Kit 96T 568 € elabsciences chicken
AE41859GO-48 ELISA test for Goat Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) 1x plate of 48 wells 402 € abebio human
AE60966RB-48 ELISA test for Rabbit Granulocyte Colony Stimulating Factor (G-CSF) 1x plate of 48 wells 373 € abebio human
AE41859GO Goat Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE41859GO-96 Goat Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) ELISA Kit 1x plate of 96 wells 671 € abebio human
GWB-1A0984 Granulocyte Colony-Stimulating Factor (G-CSF) 1 x 1 vial 579 € genways human
HYB181-LTD Granulocyte Colony Stimulating Factor (G-CSF), Clone Cocktail, Mouse Monoclonal antibody- 0.2mg Ask price € accurate-monoclonals mouse
GWB-CA1107 Granulocyte-Colony Stimulating Factor (G-CSF) Mouse 1 vial 579 € genways mouse
GWB-2E8E19 Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) 1 x 1 vial 579 € genways human
GWB-21898B GRANULOCYTE MACROPHAGE COLONY STIMULATING FACTOR (GM-CSF), antibody 1 x 1 vial 568 € genways human
GWB-4CF8A5 GRANULOCYTE MACROPHAGE COLONY STIMULATING FACTOR (GM-CSF), antibody 1 x 1 vial 1110 € genways human