| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PC4 / Positive cofactor 4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This PC4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P53999 |
| Purity: |
Antigen affinity |
| Description: |
Positive controls are the same as the target vector or antibody or protein and can be spiked to the sample before the analysis starts |
| Immunogen: |
Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PC4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Group: |
positif |
| Gene target: |
PC4 / cofactor 4 |
| Short name: |
PC4 Antibody / Positive cofactor 4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PC4 (Antibody to) / Positive cofactor 4 |
| Alternative technique: |
antibodies |
| Identity: |
5456 |
| Gene: |
IFRD1 |
More about : IFRD1 |
| Long gene name: |
interferon related developmental regulator 1 |
| Synonyms gene name: |
interferon-related developmental regulator 1 |
| Synonyms: |
PC4 TIS7 |
| Locus: |
7q31, 1 |
| Discovery year: |
1998-01-21 |
| GenBank acession: |
Y10313 |
| Entrez gene record: |
3475 |
| Pubmed identfication: |
9722946 |
| RefSeq identity: |
NM_001550 |
| Havana BLAST/BLAT: |
OTTHUMG00000155124 |