PC4 Antibody / Positive cofactor 4

Contact us
Catalog number: R32566
Price: 406 €
Supplier: NJS poly
Product name: PC4 Antibody / Positive cofactor 4
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PC4 / Positive cofactor 4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PC4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P53999
Purity: Antigen affinity
Description: Positive controls are the same as the target vector or antibody or protein and can be spiked to the sample before the analysis starts
Immunogen: Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PC4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Group: positif
Gene target: PC4 / cofactor 4
Short name: PC4 Antibody / Positive cofactor 4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PC4 (Antibody to) / Positive cofactor 4
Alternative technique: antibodies
Identity: 5456
Gene: IFRD1 | More about : IFRD1
Long gene name: interferon related developmental regulator 1
Synonyms gene name: interferon-related developmental regulator 1
Synonyms: PC4 TIS7
Locus: 7q31, 1
Discovery year: 1998-01-21
GenBank acession: Y10313
Entrez gene record: 3475
Pubmed identfication: 9722946
RefSeq identity: NM_001550
Havana BLAST/BLAT: OTTHUMG00000155124

Related Products :