SCTR Antibody

Contact us
Catalog number: R32564
Price: 406 €
Supplier: NJS poly
Product name: SCTR Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SCTR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This SCTR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P47872
Purity: Antigen affinity
Description: It binds secretin which is the most potent regulator of pancreatic bicarbonate, Secretin and its receptor are suggested to be involved in pancreatic cancer and autism, The SCTR gene is mapped to chromosome 2q14, electrolyte and volume secretion, 1 by fluorescence in situ hybridization, Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family
Immunogen: Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SCTR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SCTR
Short name: SCTR Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SCTR (Antibody to)
Alternative technique: antibodies
Identity: 10608
Gene: SCTR | More about : SCTR
Long gene name: secretin receptor
Locus: 2q14, 2
Discovery year: 1994-01-27
Entrez gene record: 6344
Pubmed identfication: 1646711
Classification: Glucagon receptor family
Havana BLAST/BLAT: OTTHUMG00000131407

Related Products :