| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SCTR |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This SCTR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P47872 |
| Purity: |
Antigen affinity |
| Description: |
It binds secretin which is the most potent regulator of pancreatic bicarbonate, Secretin and its receptor are suggested to be involved in pancreatic cancer and autism, The SCTR gene is mapped to chromosome 2q14, electrolyte and volume secretion, 1 by fluorescence in situ hybridization, Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family |
| Immunogen: |
Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SCTR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SCTR |
| Short name: |
SCTR Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SCTR (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
10608 |
| Gene: |
SCTR |
More about : SCTR |
| Long gene name: |
secretin receptor |
| Locus: |
2q14, 2 |
| Discovery year: |
1994-01-27 |
| Entrez gene record: |
6344 |
| Pubmed identfication: |
1646711 |
| Classification: |
Glucagon receptor family |
| Havana BLAST/BLAT: |
OTTHUMG00000131407 |