| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PSMA4 / Proteasome 20S alpha 4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This PSMA4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P25789 |
| Purity: |
Antigen affinity |
| Description: |
2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, Three alternatively spliced transcript variants encoding different isoforms have been found for this gene, also known as macropain subunit C9, and 20S proteasome subunit alpha-3, is a protein that in humans is encoded by the PSMA4 gene, is the processing of class I MHC peptides, proteasome component C9, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-4 |
| Immunogen: |
Amino acids 84-123 (NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ) from the human protein were used as the immunogen for the PSMA4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
nuclear, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PSMA4 / Proteasome 20S alpha 4 |
| Short name: |
PSMA4 Antibody / Proteasome 20S alpha 4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
4 (Antibody to) / protein degradation aggregate 20S a 4, a classification, macropain) subunit, proteasome (prosome |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
4, HC9 and HsT17706 and PSC9, PSMA4 and IDBG-24777 and ENSG00000041357 and 5685, PSMA4 and IDBG-631088 and ENSBTAG00000014440 and 510423, Psma4 and IDBG-167326 and ENSMUSG00000032301 and 26441, TAP-dependent and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0006521 and regulation of cellular amino acid metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006977 and DNA damage response, alpha type, alpha-subunit complex and cellular component this GO :0031145 and anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0034641 and cellular nitrogen compound metabolic process and biological process this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0051436 and negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051437 and positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051439 and regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, macropain) subunit, nuclei, protein binding, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0010467 and gene expression and biological process this GO :0016032 and viral process and biological process this GO :0016070 and RNA metabolic process and biological process this GO :0016071 and mRNA metabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000209 and protein polyubiquitination and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0000502 and proteasome complex and cellular component this GO :0000932 and cytoplasmic mRNA processing body and cellular component this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004298 : threonine-type endopeptidase activity and also this GO :0005515 : protein binding, this GO :0004298 : threonine-type endopeptidase activity, this GO :0005515 : protein binding, proteasome (prosome |
| Identity: |
9533 |
| Gene: |
PSMA4 |
More about : PSMA4 |
| Long gene name: |
proteasome subunit alpha 4 |
| Synonyms gene name: |
4 , alpha type, macropain) subunit, proteasome (prosome |
| Synonyms: |
HC9 HsT17706 |
| Locus: |
15q25, 1 |
| Discovery year: |
1995-05-03 |
| GenBank acession: |
BC005361 |
| Entrez gene record: |
5685 |
| Pubmed identfication: |
2025653 |
| RefSeq identity: |
NM_002789 |
| Classification: |
Proteasome |
| Havana BLAST/BLAT: |
OTTHUMG00000143859 |