PSMA3 Antibody / Proteasome 20S alpha 3

Contact us
Catalog number: R32557
Price: 406 €
Supplier: NJS poly
Product name: PSMA3 Antibody / Proteasome 20S alpha 3
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PSMA3 / Proteasome 20S alpha 3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PSMA3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P25788
Purity: Antigen affinity
Description: 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, Two alternative transcripts encoding different isoforms have been identified, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene, is the processing of class I MHC peptides, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-3
Immunogen: Amino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: nuclear, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PSMA3 / Proteasome 20S alpha 3
Short name: PSMA3 Antibody / Proteasome 20S alpha 3
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: 3 (Antibody to) / protein degradation aggregate 20S a 3, a classification, macropain) subunit, proteasome (prosome
Alternative technique: antibodies
Alternative to gene target: 3, HC8 and PSC3, PSMA3 and IDBG-646732 and ENSBTAG00000002808 and 505176, PSMA3 and IDBG-7749 and ENSG00000100567 and 5684, Psma3 and IDBG-146271 and ENSMUSG00000060073 and 19167, TAP-dependent and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0006521 and regulation of cellular amino acid metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006977 and DNA damage response, alpha type, alpha-subunit complex and cellular component this GO :0031145 and anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0034641 and cellular nitrogen compound metabolic process and biological process this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0051436 and negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051437 and positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051439 and regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, macropain) subunit, nuclei, protein binding, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0010467 and gene expression and biological process this GO :0016032 and viral process and biological process this GO :0016070 and RNA metabolic process and biological process this GO :0016071 and mRNA metabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000209 and protein polyubiquitination and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0000502 and proteasome complex and cellular component this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004298 : threonine-type endopeptidase activity and also this GO :0005515 : protein binding, this GO :0004298 : threonine-type endopeptidase activity, this GO :0005515 : protein binding, proteasome (prosome
Identity: 9532
Gene: PSMA3 | More about : PSMA3
Long gene name: proteasome subunit alpha 3
Synonyms gene name: 3 , alpha type, macropain) subunit, proteasome (prosome
Synonyms: HC8
Locus: 14q23, 1
Discovery year: 1995-05-03
Entrez gene record: 5684
Pubmed identfication: 2025653 8811196
RefSeq identity: NM_002788
Classification: Proteasome
Havana BLAST/BLAT: OTTHUMG00000140319

Related Products :