| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PSMA1 / Proteasome 20S alpha 1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This PSMA1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P25786 |
| Purity: |
Antigen affinity |
| Description: |
2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, Alternative splicing results in multiple transcript variants encoding distinct isoforms, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, is the processing of class I MHC peptides, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene |
| Immunogen: |
Amino acids 159-204 (MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQD) from the human protein were used as the immunogen for the PSMA1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
nuclear, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PSMA1 / Proteasome 20S alpha 1 |
| Short name: |
PSMA1 Antibody / Proteasome 20S alpha 1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
proteasome subunit a classification-1 isoform 3 (Antibody to) / protein degradation aggregate 20S a 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
HC2 and HEL-S-275 and NU and PROS30, PSMA1 and IDBG-545891 and ENSG00000256206 and 5682, alpha-subunit complex and cellular component this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process, nuclei, this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004298 : threonine-type endopeptidase activity, this GO :0004298 : threonine-type endopeptidase activity, threonine-type endopeptidase activity, proteasome subunit alpha type-1 isoform 3 |
| Identity: |
9530 |
| Gene: |
PSMA1 |
More about : PSMA1 |
| Long gene name: |
proteasome subunit alpha 1 |
| Synonyms gene name: |
1 , alpha type, macropain) subunit, proteasome (prosome |
| Synonyms: |
HC2 NU PROS30 MGC14542 MGC14575 MGC14751 MGC1667 MGC21459 MGC22853 MGC23915 |
| Locus: |
11p15, 2 |
| Discovery year: |
1995-05-03 |
| GenBank acession: |
X61969 |
| Entrez gene record: |
5682 |
| Pubmed identfication: |
1398136 2025653 |
| RefSeq identity: |
NM_002786 |
| Classification: |
Proteasome |
| Havana BLAST/BLAT: |
OTTHUMG00000165825 |