PSMA1 Antibody / Proteasome 20S alpha 1

Contact us
Catalog number: R32555
Price: 406 €
Supplier: NJS poly
Product name: PSMA1 Antibody / Proteasome 20S alpha 1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PSMA1 / Proteasome 20S alpha 1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PSMA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P25786
Purity: Antigen affinity
Description: 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, Alternative splicing results in multiple transcript variants encoding distinct isoforms, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, is the processing of class I MHC peptides, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene
Immunogen: Amino acids 159-204 (MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQD) from the human protein were used as the immunogen for the PSMA1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: nuclear, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PSMA1 / Proteasome 20S alpha 1
Short name: PSMA1 Antibody / Proteasome 20S alpha 1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: proteasome subunit a classification-1 isoform 3 (Antibody to) / protein degradation aggregate 20S a 1
Alternative technique: antibodies
Alternative to gene target: HC2 and HEL-S-275 and NU and PROS30, PSMA1 and IDBG-545891 and ENSG00000256206 and 5682, alpha-subunit complex and cellular component this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process, nuclei, this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004298 : threonine-type endopeptidase activity, this GO :0004298 : threonine-type endopeptidase activity, threonine-type endopeptidase activity, proteasome subunit alpha type-1 isoform 3
Identity: 9530
Gene: PSMA1 | More about : PSMA1
Long gene name: proteasome subunit alpha 1
Synonyms gene name: 1 , alpha type, macropain) subunit, proteasome (prosome
Synonyms: HC2 NU PROS30 MGC14542 MGC14575 MGC14751 MGC1667 MGC21459 MGC22853 MGC23915
Locus: 11p15, 2
Discovery year: 1995-05-03
GenBank acession: X61969
Entrez gene record: 5682
Pubmed identfication: 1398136 2025653
RefSeq identity: NM_002786
Classification: Proteasome
Havana BLAST/BLAT: OTTHUMG00000165825

Related Products :