PML Antibody / Promyelocytic leukemia protein

Contact us
Catalog number: R32553
Price: 311 €
Supplier: acr
Product name: PML Antibody / Promyelocytic leukemia protein
Quantity: 0,1 mg
Other quantities: 0.1mg 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PML / Promyelocytic leukemia protein
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PML antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q60953
Purity: Antigen affinity
Description: DNA damage response, and viral defense mechanisms, apoptosis, including tumor suppression, senescence, transcriptional regulation, Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes
Immunogen: Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PML antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic (isoform dependent), Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PML / Promyelocytic leukemia protein
Short name: PML Antibody / Promyelocytic leukemia protein
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: promyelocytic leukemia (Antibody to) / Promyelocytic leukemia protein
Alternative technique: antibodies
Alternative to gene target: DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006461 and protein complex assembly and biological process this GO :0006605 and protein targeting and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006977 and DNA damage response, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048384 and retinoic acid receptor signaling pathway and biological process this GO :0050821 and protein stabilization and biological process this GO :0050897 and cobalt ion binding and molecular function this GO :0051457 and maintenance of protein location in nucleus and biological process this GO :0051607 and defense response to virus and biological process this GO :0051974 and negative regulation of telomerase activity and biological process this GO :0060058 and positive regulation of apoptotic process involved in mammary gland involution and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0072332 and intrinsic apoptotic signaling pathway by p53 class mediator and biological process this GO :0090398 and cellular senescence and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1902187 and negative regulation of viral release from host cell and biological process this GO :2000059 and negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process and biological process this GO :2000779 and regulation of double-strand break repair and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, MYL and PP8675 and RNF71 and TRIM19, PML and IDBG-21462 and ENSG00000140464 and 5371, PML and IDBG-631902 and ENSBTAG00000015779 and 100138545, Pml and IDBG-171712 and ENSMUSG00000036986 and 18854, cobalt ion binding, nuclei, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007569 and cell aging and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008631 and intrinsic apoptotic signaling pathway in response to oxidative stress and biological process this GO :0009411 and response to UV and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0010522 and regulation of calcium ion transport into cytosol and biological process this GO :0016032 and viral process and biological process this GO :0016363 and nuclear matrix and cellular component this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0016605 and PML body and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030099 and myeloid cell differentiation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030578 and PML body organization and biological process this GO :0031065 and positive regulation of histone deacetylation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0031901 and early endosome membrane and cellular component this GO :0031965 and nuclear membrane and cellular component this GO :0032183 and SUMO binding and molecular function this GO :0032211 and negative regulation of telomere maintenance via telomerase and biological process this GO :0032469 and endoplasmic reticulum calcium ion homeostasis and biological process this GO :0032922 and circadian regulation of gene expression and biological process this GO :0032938 and negative regulation of translation in response to oxidative stress and biological process this GO :0034097 and response to cytokine and biological process this GO :0042406 and extrinsic component of endoplasmic reticulum membrane and cellular component this GO :0042752 and regulation of circadian rhythm and biological process this GO :0042771 and intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043153 and entrainment of circadian clock by photoperiod and biological process this GO :0043161 and proteasome-mediated ubiquitin-dependent protein catabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045165 and cell fate commitment and biological process this GO :0045343 and regulation of MHC class I biosynthetic process and biological process this GO :0045892 and negative regulation of transcription, this GO :0001666 and response to hypoxia and biological process this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0002230 and positive regulation of defense response to virus by host and biological process this GO :0003677 and DNA binding and molecular function this GO :0003713 and transcription coactivator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003713 : transcription coactivator activity and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0032183 : SUMO binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046332 : SMAD binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0050897 : cobalt ion binding, this GO :0003713 : transcription coactivator activity, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0032183 : SUMO binding, this GO :0042803 : protein homodimerization activity, this GO :0046332 : SMAD binding, this GO :0046982 : protein heterodimerization activity, this GO :0050897 : cobalt ion binding, promyelocytic leukemia
Identity: 9113
Gene: PML | More about : PML
Long gene name: promyelocytic leukemia
Synonyms: MYL TRIM19 RNF71
Locus: 15q24, 1
Discovery year: 1991-06-05
GenBank acession: AB208950
Entrez gene record: 5371
RefSeq identity: NM_002675
Classification: Tripartite motif containing Ring finger proteins
Havana BLAST/BLAT: OTTHUMG00000137607
Locus Specific Databases: LRG_1069

Related Products :

GENTAUR-58bdc61712df7 Anti- Promyelocytic Leukemia Protein (PML) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc61768dc4 Anti- Promyelocytic Leukemia Protein (PML) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd0bd17172 Anti- Promyelocytic Leukemia Protein (PML) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd90f3e9be Anti- Promyelocytic Leukemia Protein (PML) Antibody 100ug 564 € MBS Polyclonals human
R32552 PML Antibody / Promyelocytic leukemia protein 0.1mg 406 € NJS poly human
R32553 PML Antibody / Promyelocytic leukemia protein 0.1mg 406 € NJS poly human
GWB-62A3DF Promyelocytic Leukemia (PML) Mouse antibody to or anti-Mouse Monoclonal antibody 1 tube 602 € genways mouse
DL-PML-Hu Human Promyelocytic Leukemia Protein PML ELISA Kit 96T 904 € DL elisas human
EKU06838 Promyelocytic Leukemia Protein (PML) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS624594 ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) Antibody 200ul 603 € MBS Polyclonals_1 human
HCLS-17009 HL-60 Cell Slide (Human (36yrs, Female) peripheral blood promyeloblast, acute promyelocytic leukemia) (5 slides/pk) 1 pk 289 € adi human
HCL-1209 Human HL60 (Promyelocytic Leukemia) lysate 100μg 275 € adi human
MBS592324 Purified Anti-human Promyeloctic Leukemia Gene product (PML) PAb 100ug 464 € MBS Polyclonals_1 human
GENTAUR-58b8e38e1ddcf Myeloproliferative leukemia virus Myeloproliferative leukemia protein (V-MPL) 1000ug 1531 € MBS Recombinant Proteins human
GENTAUR-58b8e38e5dd58 Myeloproliferative leukemia virus Myeloproliferative leukemia protein (V-MPL) 1000ug 2033 € MBS Recombinant Proteins human
GENTAUR-58b9dfa759739 Myeloproliferative leukemia virus Myeloproliferative leukemia protein (V-MPL) 1000ug 1531 € MBS Recombinant Proteins human
GENTAUR-58b9dfa7bce4f Myeloproliferative leukemia virus Myeloproliferative leukemia protein (V-MPL) 1000ug 2033 € MBS Recombinant Proteins human
T18-001-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Lymphoblastic Leukemia) Antibody 0,1 mg 311 € acr human
T18-002-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Lymphoblastic Leukemia) Antibody 0,1 mg 311 € acr human
T18-003-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Lymphoblastic Leukemia) Antibody 0,1 mg 311 € acr human
T18-004-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Lymphoblastic Leukemia) Antibody 0,1 mg 311 € acr human
T18-005-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Lymphoblastic Leukemia) Antibody 0,1 mg 311 € acr human
T18-012-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-013-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-014-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-015-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-016-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-017-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-018-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human
T18-019-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Myeloid Leukemia) Antibody 0,1 mg 311 € acr human