| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PML / Promyelocytic leukemia protein |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This PML antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q60953 |
| Purity: |
Antigen affinity |
| Description: |
DNA damage response, and viral defense mechanisms, apoptosis, including tumor suppression, senescence, transcriptional regulation, Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes |
| Immunogen: |
Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PML antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic (isoform dependent), Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PML / Promyelocytic leukemia protein |
| Short name: |
PML Antibody / Promyelocytic leukemia protein |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
promyelocytic leukemia (Antibody to) / Promyelocytic leukemia protein |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006461 and protein complex assembly and biological process this GO :0006605 and protein targeting and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006977 and DNA damage response, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048384 and retinoic acid receptor signaling pathway and biological process this GO :0050821 and protein stabilization and biological process this GO :0050897 and cobalt ion binding and molecular function this GO :0051457 and maintenance of protein location in nucleus and biological process this GO :0051607 and defense response to virus and biological process this GO :0051974 and negative regulation of telomerase activity and biological process this GO :0060058 and positive regulation of apoptotic process involved in mammary gland involution and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0072332 and intrinsic apoptotic signaling pathway by p53 class mediator and biological process this GO :0090398 and cellular senescence and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1902187 and negative regulation of viral release from host cell and biological process this GO :2000059 and negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process and biological process this GO :2000779 and regulation of double-strand break repair and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, MYL and PP8675 and RNF71 and TRIM19, PML and IDBG-21462 and ENSG00000140464 and 5371, PML and IDBG-631902 and ENSBTAG00000015779 and 100138545, Pml and IDBG-171712 and ENSMUSG00000036986 and 18854, cobalt ion binding, nuclei, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007569 and cell aging and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008631 and intrinsic apoptotic signaling pathway in response to oxidative stress and biological process this GO :0009411 and response to UV and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0010522 and regulation of calcium ion transport into cytosol and biological process this GO :0016032 and viral process and biological process this GO :0016363 and nuclear matrix and cellular component this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0016605 and PML body and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030099 and myeloid cell differentiation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030578 and PML body organization and biological process this GO :0031065 and positive regulation of histone deacetylation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0031901 and early endosome membrane and cellular component this GO :0031965 and nuclear membrane and cellular component this GO :0032183 and SUMO binding and molecular function this GO :0032211 and negative regulation of telomere maintenance via telomerase and biological process this GO :0032469 and endoplasmic reticulum calcium ion homeostasis and biological process this GO :0032922 and circadian regulation of gene expression and biological process this GO :0032938 and negative regulation of translation in response to oxidative stress and biological process this GO :0034097 and response to cytokine and biological process this GO :0042406 and extrinsic component of endoplasmic reticulum membrane and cellular component this GO :0042752 and regulation of circadian rhythm and biological process this GO :0042771 and intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043153 and entrainment of circadian clock by photoperiod and biological process this GO :0043161 and proteasome-mediated ubiquitin-dependent protein catabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045165 and cell fate commitment and biological process this GO :0045343 and regulation of MHC class I biosynthetic process and biological process this GO :0045892 and negative regulation of transcription, this GO :0001666 and response to hypoxia and biological process this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0002230 and positive regulation of defense response to virus by host and biological process this GO :0003677 and DNA binding and molecular function this GO :0003713 and transcription coactivator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003713 : transcription coactivator activity and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0032183 : SUMO binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046332 : SMAD binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0050897 : cobalt ion binding, this GO :0003713 : transcription coactivator activity, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0032183 : SUMO binding, this GO :0042803 : protein homodimerization activity, this GO :0046332 : SMAD binding, this GO :0046982 : protein heterodimerization activity, this GO :0050897 : cobalt ion binding, promyelocytic leukemia |
| Identity: |
9113 |
| Gene: |
PML |
More about : PML |
| Long gene name: |
promyelocytic leukemia |
| Synonyms: |
MYL TRIM19 RNF71 |
| Locus: |
15q24, 1 |
| Discovery year: |
1991-06-05 |
| GenBank acession: |
AB208950 |
| Entrez gene record: |
5371 |
| RefSeq identity: |
NM_002675 |
| Classification: |
Tripartite motif containing Ring finger proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000137607 |
| Locus Specific Databases: |
LRG_1069 |