PIAS4 Antibody / PIASg

Contact us
Catalog number: R32550
Price: 406 €
Supplier: NJS poly
Product name: PIAS4 Antibody / PIASg
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PIAS4 / PIASg
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PIAS4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q8N2W9
Purity: Antigen affinity
Description: It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, This gene involved in gene silencing, This gene is mapped to 19p13, This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, and as a SUMO-tethering factor, including the STAT pathway, is an enzyme that in humans is encoded by the PIAS4 gene, stabilizing the interaction between UBE2I and the substrate, the Wnt pathway and the steroid hormone signaling pathway, the p53/TP53 pathway, 3, Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy)
Immunogen: Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PIAS4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PIAS4 / PIASg
Short name: PIAS4 Antibody / PIASg
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PIAS4 (Antibody to) / PIASg
Alternative technique: antibodies
Identity: 17002
Gene: PIAS4 | More about : PIAS4
Long gene name: protein inhibitor of activated STAT 4
Synonyms: Piasg PIASY FLJ12419 ZMIZ6
Synonyms name: MIZ-type containing 6 , zinc finger
Locus: 19p13, 3
Discovery year: 2004-06-02
GenBank acession: AF077952
Entrez gene record: 51588
Pubmed identfication: 9724754
RefSeq identity: NM_015897
Classification: Zinc fingers MIZ-type
Havana BLAST/BLAT: OTTHUMG00000181759

Related Products :