DHODH Antibody

Contact us
Catalog number: R32524
Price: 600 €
Supplier: ABM lentivectors
Product name: DHODH Antibody
Quantity: 1.0 µg DNA
Other quantities: 1 vial 486€ 1 x 1 vial 411€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: DHODH
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This DHODH antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q02127
Purity: Antigen affinity
Description: The protein encoded by this gene catalyzes the fourth enzymatic step, This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane, in de novo pyrimidine biosynthesis, the ubiquinone-mediated oxidation of dihydroorotate to orotate, Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16
Immunogen: Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DHODH antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: DHODH
Short name: DHODH Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: dihydroorotate dehydrogenase (quinone) (Antibody to)
Alternative technique: antibodies
Alternative to gene target: DHODH and IDBG-41409 and ENSG00000102967 and 1723, DHODH and IDBG-634716 and ENSBTAG00000046908 and, DHOdehase and POADS and URA1, Dhodh and IDBG-191275 and ENSMUSG00000031730 and 56749, Plasma membranes, this GO :0004152 and dihydroorotate dehydrogenase activity and molecular function this GO :0004158 and dihydroorotate oxidase activity and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0006206 and pyrimidine nucleobase metabolic process and biological process this GO :0006207 and 'de novo' pyrimidine nucleobase biosynthetic process and biological process this GO :0006222 and UMP biosynthetic process and biological process this GO :0007565 and female pregnancy and biological process this GO :0007595 and lactation and biological process this GO :0008144 and drug binding and molecular function this GO :0010181 and FMN binding and molecular function this GO :0014070 and response to organic cyclic compound and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031000 and response to caffeine and biological process this GO :0042493 and response to drug and biological process this GO :0042594 and response to starvation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0044205 and 'de novo' UMP biosynthetic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0046134 and pyrimidine nucleoside biosynthetic process and biological process this GO :0048039 and ubiquinone binding and molecular function this GO :0055086 and nucleobase-containing small molecule metabolic process and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0090140 and regulation of mitochondrial fission and biological process, this GO :0004152 : dihydroorotate dehydrogenase activity, this GO :0004152 : dihydroorotate dehydrogenase activity and also this GO :0004158 : dihydroorotate oxidase activity and also this GO :0008144 : drug binding and also this GO :0010181 : FMN binding and also this GO :0048039 : ubiquinone binding, this GO :0004158 : dihydroorotate oxidase activity, this GO :0008144 : drug binding, this GO :0010181 : FMN binding, this GO :0048039 : ubiquinone binding, ubiquinone binding, dihydroorotate dehydrogenase (quinone)
Identity: 2867
Gene: DHODH | More about : DHODH
Long gene name: dihydroorotate dehydrogenase (quinone)
Synonyms gene name: dihydroorotate dehydrogenase
Locus: 16q22, 2
Discovery year: 1993-06-29
Entrez gene record: 1723
Pubmed identfication: 8211381
RefSeq identity: NM_001361
Havana BLAST/BLAT: OTTHUMG00000178093

Related Products :

A01D0039 anti-DHODH Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bde9b6f32e7 Anti- DHODH Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde9b76325e Anti- DHODH Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be414de0a0c Anti- DHODH Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be58d6ac788 Anti- DHODH Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be58d725ba8 Anti- DHODH Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be58d77f719 Anti- DHODH Antibody 50ug 304 € MBS Polyclonals human
abx147621 Anti-DHODH Antibody inquire 50 € abbex human
abx225142 Anti-DHODH Antibody 100 μl 383 € abbex human
GWB-1BC3FF DHODH antibody 1 x 1 vial 411 € genways human
GWB-8C5314 DHODH antibody 1 vial 486 € genways human
GWB-E42363 DHODH antibody 1 vial 486 € genways human
GWB-MN980H DHODH antibody 1 vial 521 € genways human
GWB-MN998H DHODH antibody 1 vial 521 € genways human
R32524 DHODH Antibody 0.1mg 406 € NJS poly human
BIN-001723-M01 DHODH Antibody (M01), clone 6E1 0.1mg 495 € Zyagen human
YSRTMCA3050Z DHODH, Mouse Monoclonal antibody-; Clone: 6E1 0.1 mg Ask price € accurate-monoclonals mouse
GWB-ASE528 Human DHODH Antibody bulk Ask price € genways bulk human
abx901486 Anti-DHODH siRNA 15 nmol 528 € abbex human
abx914091 Anti-DHODH siRNA 30 nmol 717 € abbex human
abx914092 Anti-DHODH siRNA inquire 50 € abbex human
abx151311 Anti-Human DHODH ELISA Kit 96 tests 934 € abbex human
abx571153 Anti-Human DHODH ELISA Kit inquire 50 € abbex human
abx153915 Anti-Mouse DHODH ELISA Kit inquire 50 € abbex mouse
abx571442 Anti-Mouse DHODH ELISA Kit 96 tests 804 € abbex mouse
GWB-P0423G DHODH, 31-395aa, Recombinant Protein bulk Ask price € genways bulk human
LV136335 DHODH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV136336 DHODH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV136337 DHODH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV136338 DHODH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human