| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
DHODH |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This DHODH antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q02127 |
| Purity: |
Antigen affinity |
| Description: |
The protein encoded by this gene catalyzes the fourth enzymatic step, This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane, in de novo pyrimidine biosynthesis, the ubiquinone-mediated oxidation of dihydroorotate to orotate, Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16 |
| Immunogen: |
Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DHODH antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
DHODH |
| Short name: |
DHODH Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
dihydroorotate dehydrogenase (quinone) (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DHODH and IDBG-41409 and ENSG00000102967 and 1723, DHODH and IDBG-634716 and ENSBTAG00000046908 and, DHOdehase and POADS and URA1, Dhodh and IDBG-191275 and ENSMUSG00000031730 and 56749, Plasma membranes, this GO :0004152 and dihydroorotate dehydrogenase activity and molecular function this GO :0004158 and dihydroorotate oxidase activity and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0006206 and pyrimidine nucleobase metabolic process and biological process this GO :0006207 and 'de novo' pyrimidine nucleobase biosynthetic process and biological process this GO :0006222 and UMP biosynthetic process and biological process this GO :0007565 and female pregnancy and biological process this GO :0007595 and lactation and biological process this GO :0008144 and drug binding and molecular function this GO :0010181 and FMN binding and molecular function this GO :0014070 and response to organic cyclic compound and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031000 and response to caffeine and biological process this GO :0042493 and response to drug and biological process this GO :0042594 and response to starvation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0044205 and 'de novo' UMP biosynthetic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0046134 and pyrimidine nucleoside biosynthetic process and biological process this GO :0048039 and ubiquinone binding and molecular function this GO :0055086 and nucleobase-containing small molecule metabolic process and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0090140 and regulation of mitochondrial fission and biological process, this GO :0004152 : dihydroorotate dehydrogenase activity, this GO :0004152 : dihydroorotate dehydrogenase activity and also this GO :0004158 : dihydroorotate oxidase activity and also this GO :0008144 : drug binding and also this GO :0010181 : FMN binding and also this GO :0048039 : ubiquinone binding, this GO :0004158 : dihydroorotate oxidase activity, this GO :0008144 : drug binding, this GO :0010181 : FMN binding, this GO :0048039 : ubiquinone binding, ubiquinone binding, dihydroorotate dehydrogenase (quinone) |
| Identity: |
2867 |
| Gene: |
DHODH |
More about : DHODH |
| Long gene name: |
dihydroorotate dehydrogenase (quinone) |
| Synonyms gene name: |
dihydroorotate dehydrogenase |
| Locus: |
16q22, 2 |
| Discovery year: |
1993-06-29 |
| Entrez gene record: |
1723 |
| Pubmed identfication: |
8211381 |
| RefSeq identity: |
NM_001361 |
| Havana BLAST/BLAT: |
OTTHUMG00000178093 |