CYP3A4 Antibody

Contact us
Catalog number: R32523
Price: 406 €
Supplier: NJS poly
Product name: CYP3A4 Antibody
Quantity: 0.1mg
Other quantities: 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: CYP3A4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This CYP3A4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P08684
Purity: Antigen affinity
Description: Alternatively spliced transcript variants encoding different isoforms have been identified, CYP3A3, Previously another CYP3A gene, The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, The enzyme also metabolizes some steroids and carcinogens, This enzyme is involved in the metabolism of approximately half the drugs in use today, This gene encodes a member of the cytochrome P450 superfamily of enzymes, This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21, This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents, codeine, cyclosporin A, diazepam and erythromycin, however, including acetaminophen, is an important enzyme in the body, it is now thought that this sequence represents a transcript variant of CYP3A4, mainly found in the liver and in the intestine, steroids and other lipids, was thought to exist, 1, Cytochrome P450 3A4 (abbreviated CYP3A4)
Immunogen: Amino acids 237-277 (NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID) from the human protein were used as the immunogen for the CYP3A4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CYP3A4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: CYP3A4
Short name: CYP3A4 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: CYP3A4 (Antibody to)
Alternative technique: antibodies
Identity: 2637
Gene: CYP3A4 | More about : CYP3A4
Long gene name: cytochrome P450 family 3 subfamily A member 4
Synonyms gene: CYP3A3
Synonyms gene name: cytochrome P450, family 3, polypeptide 4 , polypeptide 4 cytochrome P450, subfamily A, subfamily IIIA (niphedipine oxidase)
Locus: 7q22, 1
Discovery year: 1990-02-24
GenBank acession: AF280107
Entrez gene record: 1576
Pubmed identfication: 8269949 1391968
Classification: Cytochrome P450 family 3
Havana BLAST/BLAT: OTTHUMG00000156651
Locus Specific Databases: Human Cytochrome P450 (CYP) Allele Nomenclature Committee

Related Products :