| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
AMACR / p504S (Prostate Cancer Marker) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This AMACR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9UHK6 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants have been described, Encoded proteins from this locus localize to both mitochondria and peroxisomes, It encodes a racemase, Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene, The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation, The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers, and adrenomyeloneuropathy due to defects in bile acid synthesis, pigmentary retinopathy, Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme |
| Immunogen: |
Amino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AMACR antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
AMACR / p504S (Prostate Cancer |
| Short name: |
AMACR / p504S Antibody (Prostate Cancer Marker) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
AMACR / p504S (Antibody to) (Prostate Cancer detection labelled) |
| Alternative technique: |
antibodies |
| Identity: |
451 |
| Gene: |
AMACR |
More about : AMACR |
| Long gene name: |
alpha-methylacyl-CoA racemase |
| Synonyms: |
RACE P504S |
| Locus: |
5p13, 2 |
| Discovery year: |
1999-10-19 |
| GenBank acession: |
AF047020 |
| Entrez gene record: |
23600 |
| Pubmed identfication: |
9307041 |
| RefSeq identity: |
NM_014324 |
| Havana BLAST/BLAT: |
OTTHUMG00000090734 |