AMACR / p504S Antibody (Prostate Cancer Marker)

Contact us
Catalog number: R32468
Price: 406 €
Supplier: NJS poly
Product name: AMACR / p504S Antibody (Prostate Cancer Marker)
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AMACR / p504S (Prostate Cancer Marker)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This AMACR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9UHK6
Purity: Antigen affinity
Description: Alternatively spliced transcript variants have been described, Encoded proteins from this locus localize to both mitochondria and peroxisomes, It encodes a racemase, Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene, The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation, The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers, and adrenomyeloneuropathy due to defects in bile acid synthesis, pigmentary retinopathy, Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme
Immunogen: Amino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AMACR antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AMACR / p504S (Prostate Cancer
Short name: AMACR / p504S Antibody (Prostate Cancer Marker)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: AMACR / p504S (Antibody to) (Prostate Cancer detection labelled)
Alternative technique: antibodies
Identity: 451
Gene: AMACR | More about : AMACR
Long gene name: alpha-methylacyl-CoA racemase
Synonyms: RACE P504S
Locus: 5p13, 2
Discovery year: 1999-10-19
GenBank acession: AF047020
Entrez gene record: 23600
Pubmed identfication: 9307041
RefSeq identity: NM_014324
Havana BLAST/BLAT: OTTHUMG00000090734

Related Products :