Aconitase 2 Antibody

Catalog number:	R32458 Buy Now
Price:	350 €
Supplier:	Bioss Primary Conjugated Antibodies.
Product name:	Aconitase 2 Antibody
Quantity:	100ul
Other quantities:	0.08 ml 199€ 0.1mg 406€ 0.4 ml 406€
Related search:	aconitase antibody gene antibodies protein synonyms identity need

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	Aconitase 2
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	1-0, 5ug/ml, Western blot: 0
Added buffer:	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use:	This Aconitase 2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	Q99798
Purity:	Antigen affinity
Description:	It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle, It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), The protein encoded by this gene belongs to the aconitase/IPM isomerase family, This protein is encoded in the nucleus and functions in the mitochondrion, after oxidative modification, also known as Lon protease, mitochondrial is a protein that in humans is encoded by the ACO2 gene, Aconitase 2
Immunogen:	Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody
Storage:	After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the Aconitase 2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization:	Cytoplasmic
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	Aconitase 2
Short name:	Aconitase 2 Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	Aconitase 2 (Antibody to)
Alternative technique:	antibodies
Identity:	118
Gene:	ACO2 | More about : ACO2
Long gene name:	aconitase 2
Synonyms gene name:	aconitase 2, mitochondrial
Synonyms:	ACONM
Synonyms name:	aconitate hydratase, mitochondrial mitochondrial aconitase
Locus:	22q13, 2
Discovery year:	1986-01-01
GenBank acession:	AH006514
Entrez gene record:	50
Pubmed identfication:	10591208
RefSeq identity:	NM_001098
Havana BLAST/BLAT:	OTTHUMG00000030544

• #aconitase
• #antibody
• #gene
• #antibodies
• #protein
• #synonyms
• #identity
• #need