| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ABR / Active BCR related |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This ABR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q12979 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants have been reported for this gene, Functional studies in mice determined that this protein plays a role in vestibular morphogenesis, The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins, This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22 |
| Immunogen: |
Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the ABR antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ABR / Active BCR related |
| Short name: |
ABR Antibody / Active BCR related |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
active BCR-related (Antibody to) / functionnal BCR related |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
ABR and IDBG-14430 and ENSG00000159842 and 29, ABR and IDBG-632555 and ENSBTAG00000008424 and 515556, Abr and IDBG-200937 and ENSMUSG00000017631 and 109934, MDB, Plasma membranes, Rac GTPase activator activity, this GO :0005089 and Rho guanyl-nucleotide exchange factor activity and molecular function this GO :0005096 and GTPase activator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007420 and brain development and biological process this GO :0016020 and membrane and cellular component this GO :0030036 and actin cytoskeleton organization and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030675 and Rac GTPase activator activity and molecular function this GO :0032321 and positive regulation of Rho GTPase activity and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0035023 and regulation of Rho protein signal transduction and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042472 and inner ear morphogenesis and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043314 and negative regulation of neutrophil degranulation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050885 and neuromuscular process controlling balance and biological process this GO :0051056 and regulation of small GTPase mediated signal transduction and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0005089 : Rho guanyl-nucleotide exchange factor activity, this GO :0005089 : Rho guanyl-nucleotide exchange factor activity and also this GO :0005096 : GTPase activator activity and also this GO :0005515 : protein binding and also this GO :0030675 : Rac GTPase activator activity, this GO :0005096 : GTPase activator activity, this GO :0005515 : protein binding, this GO :0030675 : Rac GTPase activator activity, active BCR-related |
| Identity: |
1014 |
| Gene: |
BCR |
More about : BCR |
| Long gene name: |
BCR, RhoGEF and GTPase activating protein |
| Synonyms gene: |
D22S11 BCR1 |
| Synonyms gene name: |
breakpoint cluster region |
| Synonyms: |
D22S662 CML PHL ALL |
| Locus: |
22q11, 23 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
613 |
| Pubmed identfication: |
1657398 18070886 |
| RefSeq identity: |
NM_004327 |
| Classification: |
Rho guanine nucleotide exchange factors Pleckstrin homology domain containing C2 domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000150655 |
| Locus Specific Databases: |
LRG_1112 |