ABR Antibody / Active BCR related

Contact us
Catalog number: R32457
Price: 406 €
Supplier: NJS poly
Product name: ABR Antibody / Active BCR related
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ABR / Active BCR related
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ABR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q12979
Purity: Antigen affinity
Description: Alternatively spliced transcript variants have been reported for this gene, Functional studies in mice determined that this protein plays a role in vestibular morphogenesis, The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins, This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22
Immunogen: Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the ABR antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ABR / Active BCR related
Short name: ABR Antibody / Active BCR related
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: active BCR-related (Antibody to) / functionnal BCR related
Alternative technique: antibodies
Alternative to gene target: ABR and IDBG-14430 and ENSG00000159842 and 29, ABR and IDBG-632555 and ENSBTAG00000008424 and 515556, Abr and IDBG-200937 and ENSMUSG00000017631 and 109934, MDB, Plasma membranes, Rac GTPase activator activity, this GO :0005089 and Rho guanyl-nucleotide exchange factor activity and molecular function this GO :0005096 and GTPase activator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007420 and brain development and biological process this GO :0016020 and membrane and cellular component this GO :0030036 and actin cytoskeleton organization and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030675 and Rac GTPase activator activity and molecular function this GO :0032321 and positive regulation of Rho GTPase activity and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0035023 and regulation of Rho protein signal transduction and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042472 and inner ear morphogenesis and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043314 and negative regulation of neutrophil degranulation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050885 and neuromuscular process controlling balance and biological process this GO :0051056 and regulation of small GTPase mediated signal transduction and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0005089 : Rho guanyl-nucleotide exchange factor activity, this GO :0005089 : Rho guanyl-nucleotide exchange factor activity and also this GO :0005096 : GTPase activator activity and also this GO :0005515 : protein binding and also this GO :0030675 : Rac GTPase activator activity, this GO :0005096 : GTPase activator activity, this GO :0005515 : protein binding, this GO :0030675 : Rac GTPase activator activity, active BCR-related
Identity: 1014
Gene: BCR | More about : BCR
Long gene name: BCR, RhoGEF and GTPase activating protein
Synonyms gene: D22S11 BCR1
Synonyms gene name: breakpoint cluster region
Synonyms: D22S662 CML PHL ALL
Locus: 22q11, 23
Discovery year: 1986-01-01
Entrez gene record: 613
Pubmed identfication: 1657398 18070886
RefSeq identity: NM_004327
Classification: Rho guanine nucleotide exchange factors Pleckstrin homology domain containing C2 domain containing
Havana BLAST/BLAT: OTTHUMG00000150655
Locus Specific Databases: LRG_1112

Related Products :