| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PYY / Peptide YY |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This PYY antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9EPS2 |
| Purity: |
Antigen affinity |
| Description: |
Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa, The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids, These peptides, This gene encodes a member of the neuropeptide Y (NPY) family of peptides, also known as peptide tyrosine tyrosine, exhibit different binding affinities for each of the neuropeptide Y receptors, gut mobility and energy homeostasis, is a peptide that in humans is encoded by the PYY gene, secreted by endocrine cells in the gut, Peptide YY (PYY) |
| Immunogen: |
Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the PYY antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PYY / Peptide YY |
| Short name: |
PYY Antibody / Peptide YY |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PYY (Antibody to) / short protein sequence YY |
| Alternative technique: |
antibodies |
| Identity: |
9748 |
| Gene: |
PYY |
More about : PYY |
| Long gene name: |
peptide YY |
| Synonyms: |
PYY1 |
| Synonyms name: |
prepro-PYY |
| Locus: |
17q21, 31 |
| Discovery year: |
1994-09-14 |
| Entrez gene record: |
5697 |
| Pubmed identfication: |
7782089 |
| RefSeq identity: |
NM_004160 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000181801 |