PYY Antibody / Peptide YY

Contact us
Catalog number: R32451
Price: 406 €
Supplier: NJS poly
Product name: PYY Antibody / Peptide YY
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PYY / Peptide YY
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PYY antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9EPS2
Purity: Antigen affinity
Description: Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa, The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids, These peptides, This gene encodes a member of the neuropeptide Y (NPY) family of peptides, also known as peptide tyrosine tyrosine, exhibit different binding affinities for each of the neuropeptide Y receptors, gut mobility and energy homeostasis, is a peptide that in humans is encoded by the PYY gene, secreted by endocrine cells in the gut, Peptide YY (PYY)
Immunogen: Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the PYY antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PYY / Peptide YY
Short name: PYY Antibody / Peptide YY
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PYY (Antibody to) / short protein sequence YY
Alternative technique: antibodies
Identity: 9748
Gene: PYY | More about : PYY
Long gene name: peptide YY
Synonyms: PYY1
Synonyms name: prepro-PYY
Locus: 17q21, 31
Discovery year: 1994-09-14
Entrez gene record: 5697
Pubmed identfication: 7782089
RefSeq identity: NM_004160
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000181801

Related Products :