| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TIP47 / Perilipin 3 / M6PRBP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This Perilipin 3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O60664 |
| Purity: |
Antigen affinity |
| Description: |
Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex, Multiple transcript variants encoding different isoforms have been found for this gene, The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo, The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family, also known as Perilipin 3 (PLN3) or TIP47, and is required for endosome-to-Golgi transport, is a protein which in humans is encoded by the M6PRBP1 gene, Mannose-6-phosphate receptor binding protein 1 (M6PRBP1) |
| Immunogen: |
Amino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the Perilipin 3 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TIP47 / Perilipin 3 / M6PRBP1 |
| Short name: |
TIP47 Antibody / Perilipin 3 / M6PRBP1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
TIP47 (Antibody to) / Perilipin 3 / M6PRBP1 |
| Alternative technique: |
antibodies |
| Identity: |
16893 |
| Gene: |
PLIN3 |
More about : PLIN3 |
| Long gene name: |
perilipin 3 |
| Synonyms gene: |
M6PRBP1 |
| Synonyms gene name: |
mannose-6-phosphate receptor binding protein 1 |
| Synonyms: |
TIP47 PP17 |
| Synonyms name: |
47-KD , cargo selection protein (mannose 6 phosphate receptor binding protein) placental protein 17 MPR-BINDING PROTEIN |
| Locus: |
19p13, 3 |
| Discovery year: |
2004-01-16 |
| GenBank acession: |
AF051314 |
| Entrez gene record: |
10226 |
| Pubmed identfication: |
9590177 6856484 19638644 |
| RefSeq identity: |
NM_005817 |
| Classification: |
Perilipins |
| Havana BLAST/BLAT: |
OTTHUMG00000180249 |