TIP47 Antibody / Perilipin 3 / M6PRBP1

Contact us
Catalog number: R32450
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: TIP47 Antibody / Perilipin 3 / M6PRBP1
Quantity: 100ul
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TIP47 / Perilipin 3 / M6PRBP1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This Perilipin 3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O60664
Purity: Antigen affinity
Description: Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex, Multiple transcript variants encoding different isoforms have been found for this gene, The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo, The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family, also known as Perilipin 3 (PLN3) or TIP47, and is required for endosome-to-Golgi transport, is a protein which in humans is encoded by the M6PRBP1 gene, Mannose-6-phosphate receptor binding protein 1 (M6PRBP1)
Immunogen: Amino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the Perilipin 3 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TIP47 / Perilipin 3 / M6PRBP1
Short name: TIP47 Antibody / Perilipin 3 / M6PRBP1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: TIP47 (Antibody to) / Perilipin 3 / M6PRBP1
Alternative technique: antibodies
Identity: 16893
Gene: PLIN3 | More about : PLIN3
Long gene name: perilipin 3
Synonyms gene: M6PRBP1
Synonyms gene name: mannose-6-phosphate receptor binding protein 1
Synonyms: TIP47 PP17
Synonyms name: 47-KD , cargo selection protein (mannose 6 phosphate receptor binding protein) placental protein 17 MPR-BINDING PROTEIN
Locus: 19p13, 3
Discovery year: 2004-01-16
GenBank acession: AF051314
Entrez gene record: 10226
Pubmed identfication: 9590177 6856484 19638644
RefSeq identity: NM_005817
Classification: Perilipins
Havana BLAST/BLAT: OTTHUMG00000180249

Related Products :

R32450 TIP47 Antibody / Perilipin 3 / M6PRBP1 0.1mg 406 € NJS poly human
AP32072PU-N anti-TIP47 / M6PRBP1 (154-167) Antibody 0,1 mg 558 € acr human
AP22588PU-N anti-TIP47 / M6PRBP1 Antibody 50 Вµg 732 € acr human
AP33135SU-N anti-TIP47 / M6PRBP1 (C-term) Antibody 0,1 ml 587 € acr human
BP5018 anti-TIP47 / M6PRBP1 (C-term) Antibody 0,1 ml 587 € acr human
AP30884CP-N anti-TIP47 / M6PRBP1 Control Peptide Antibody 50 Вµg 282 € acr human
AP30885CP-N anti-TIP47 / M6PRBP1 Control Peptide Antibody 50 Вµg 282 € acr human
AP08870PU-N anti-TIP47 / M6PRBP1 (N-term) Antibody 50 Вµg 732 € acr human
AP09538SU-N anti-TIP47 / M6PRBP1 (N-term) Antibody 0,1 ml 587 € acr human
BP5017 anti-TIP47 / M6PRBP1 (N-term) Antibody 0,1 ml 514 € acr human
MBS242528 Goat Polyclonal to Mouse PLIN3 / M6PRBP1 / TIP47 Antibody 50ug 597 € MBS Polyclonals_1 mouse
MBS242106 Anti-Human PLIN3 / M6PRBP1 / TIP47 50ug 597 € MBS Polyclonals_1 human
MBS422908 Goat anti-perilipin 3 / TIP47 (aa154-167) Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-80657F Mannose-6-phosphate Receptor Binding protein 1 (M6PRBP1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 volume 602 € genways human
XW-8019 anti-M6PRBP1 Antibody 0.05 mg 180 € proscience human
MBS420910 Goat anti-M6prbp1 (mouse) Antibody 100ug 370 € MBS Polyclonals_1 human
R34889-100UG M6prbp1 Antibody 0.1mg 406 € NJS poly human
LV809481 M6PRBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV809482 M6PRBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV809483 M6PRBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV809484 M6PRBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
GWB-7B5E60 antibody to or anti- TIP47 / PP17 antibody 1 tube 914 € genways human
MBS150702 TIP47 Antibody 100ug 431 € MBS Polyclonals_1 human
MBS151454 TIP47 Antibody 100ug 431 € MBS Polyclonals_1 human
MBS534607 TIP47 antibody 100ul 702 € MBS Polyclonals_1 human
R36268-100UG TIP47 Antibody 0.1mg 406 € NJS poly human
bs-2914R-A350 TIP47 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2914R-A488 TIP47 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2914R-A555 TIP47 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2914R-A594 TIP47 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human