ITLN1 Antibody / Intelectin-1

Contact us
Catalog number: R32441
Price: 406 €
Supplier: NJS poly
Product name: ITLN1 Antibody / Intelectin-1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ITLN1 / Intelectin-1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ITLN1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q8WWA0
Purity: Antigen affinity
Description: Having conserved ligand binding site residues, Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin, It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition, This gene is mapped to chromosome 1q21, also known as omentin, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose, is an intelectin encoded in humans by the ITLN1 gene, 3-q22 by genomic sequence analysis, Intelectin-1
Immunogen: Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the ITLN1 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ITLN1 / Intelectin-1
Short name: ITLN1 Antibody / Intelectin-1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ITLN1 (Antibody to) / Intelectin-1
Alternative technique: antibodies
Identity: 18259
Gene: ITLN1 | More about : ITLN1
Long gene name: intelectin 1
Synonyms gene name: intelectin 1 (galactofuranose binding)
Synonyms: ITLN FLJ20022 LFR HL-1 hIntL
Synonyms name: omentin
Locus: 1q23, 3
Discovery year: 2003-03-14
GenBank acession: AB036706
Entrez gene record: 55600
Pubmed identfication: 11313366 11181563
RefSeq identity: NM_017625
Havana BLAST/BLAT: OTTHUMG00000028604

Related Products :