| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
5 / SCNA5, Nav1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Intented use: |
5 antibodyis to be used only for research purposes and not for diagnostics, This Nav1 |
| Uniprot #: |
Q14524 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in several transcript variants encoding different isoforms, Defects in this gene are a cause of long QT syndrome type 3 (LQT3), The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit, This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram, an autosomal dominant cardiac disease, 5, SCN5A is the gene that encodes the cardiac sodium channel NaV1 |
| Immunogen: |
5 antibody, Amino acids LRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLFRQQA from the human protein were used as the immunogen for the Nav1 |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Nav1, 5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
5 / SCNA5, Nav1 |
| Short name: |
5 Antibody / SCNA5, Nav1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
5 (Antibody to) / SCNA5, Nav1 |
| Alternative technique: |
antibodies |