Nav1.5 Antibody / SCNA5

Contact us
Catalog number: R32404
Price: 406 €
Supplier: NJS poly
Product name: Nav1.5 Antibody / SCNA5
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: 5 / SCNA5, Nav1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Intented use: 5 antibodyis to be used only for research purposes and not for diagnostics, This Nav1
Uniprot #: Q14524
Purity: Antigen affinity
Description: Alternative splicing results in several transcript variants encoding different isoforms, Defects in this gene are a cause of long QT syndrome type 3 (LQT3), The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit, This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram, an autosomal dominant cardiac disease, 5, SCN5A is the gene that encodes the cardiac sodium channel NaV1
Immunogen: 5 antibody, Amino acids LRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLFRQQA from the human protein were used as the immunogen for the Nav1
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Nav1, 5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: 5 / SCNA5, Nav1
Short name: 5 Antibody / SCNA5, Nav1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: 5 (Antibody to) / SCNA5, Nav1
Alternative technique: antibodies

Related Products :