| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Cofilin 2 / CFL2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Cofilin 2 antibody should be determined by the researcher |
| Intented use: |
This Cofilin 2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9Y281 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, And this protein is a major component of intranuclear and cytoplasmic actin rods, It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, It is mapped to 14q12, Mutations in this gene cause nemaline myopathy type 7, This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics, a form of congenital myopathy, also known as CFL2, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner, is a protein which in humans is encoded by the CFL2 gene, Cofilin 2 (muscle) |
| Immunogen: |
Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Cofilin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Cofilin 2 / CFL2 |
| Short name: |
Cofilin 2 Antibody / CFL2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Cofilin 2 (Antibody to) / CFL2 |
| Alternative technique: |
antibodies |
| Identity: |
1875 |
| Gene: |
CFL2 |
More about : CFL2 |
| Long gene name: |
cofilin 2 |
| Synonyms gene name: |
cofilin 2 (muscle) |
| Synonyms: |
NEM7 |
| Synonyms name: |
nemaline myopathy type 7 |
| Locus: |
14q13, 1 |
| Discovery year: |
1995-07-11 |
| GenBank acession: |
AF087867 |
| Entrez gene record: |
1073 |
| Pubmed identfication: |
8800436 |
| RefSeq identity: |
NM_138638 |
| Havana BLAST/BLAT: |
OTTHUMG00000029536 |
| Locus Specific Databases: |
Leiden Muscular Dystrophy pages LRG_213 |