Cofilin 2 Antibody / CFL2

Contact us
Catalog number: R32400
Price: 406 €
Supplier: NJS poly
Product name: Cofilin 2 Antibody / CFL2
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Cofilin 2 / CFL2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0
Notes: Optimal dilution of the Cofilin 2 antibody should be determined by the researcher
Intented use: This Cofilin 2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9Y281
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, And this protein is a major component of intranuclear and cytoplasmic actin rods, It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, It is mapped to 14q12, Mutations in this gene cause nemaline myopathy type 7, This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics, a form of congenital myopathy, also known as CFL2, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner, is a protein which in humans is encoded by the CFL2 gene, Cofilin 2 (muscle)
Immunogen: Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Cofilin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Cofilin 2 / CFL2
Short name: Cofilin 2 Antibody / CFL2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Cofilin 2 (Antibody to) / CFL2
Alternative technique: antibodies
Identity: 1875
Gene: CFL2 | More about : CFL2
Long gene name: cofilin 2
Synonyms gene name: cofilin 2 (muscle)
Synonyms: NEM7
Synonyms name: nemaline myopathy type 7
Locus: 14q13, 1
Discovery year: 1995-07-11
GenBank acession: AF087867
Entrez gene record: 1073
Pubmed identfication: 8800436
RefSeq identity: NM_138638
Havana BLAST/BLAT: OTTHUMG00000029536
Locus Specific Databases: Leiden Muscular Dystrophy pages LRG_213

Related Products :