ZP1 Antibody / Zona pellucida sperm-binding protein 1

Catalog number:	R32398 Buy Now
Price:	3210 €
Supplier:	MBS Recombinant Proteins
Product name:	ZP1 Antibody / Zona pellucida sperm-binding protein 1
Quantity:	1000ug
Related search:	pellucida antibody gene protein antibodies glycoprotein sterile

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	ZP1 / Zona pellucida sperm-binding protein 1
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	1-0, 5ug/ml, Western blot: 0
Notes:	Optimal dilution of the ZP1 antibody should be determined by the researcher
Intented use:	This ZP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	P60852
Purity:	Antigen affinity
Description:	And this gene is mapped to chromosome 11q12, It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development, Mutations in this gene are a cause of oocyte maturation defect and infertility, The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo, Zp1 ensures the structural integrity of the zona pellucida, 2, Zona pellucida sperm-binding protein 1 is a protein that belopngs to the mammalian zona pellucida
Immunogen:	Amino acids HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD were used as the immunogen for the ZP1 antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ZP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	ZP1 / Zona pellucida sperm-binding protein 1
Short name:	ZP1 Antibody / Zona pellucida sperm-binding protein 1
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	ZP1 (Antibody to) / Zona pellucida sperm-binding protein 1
Alternative technique:	antibodies
Identity:	13187
Gene:	ZP1 | More about : ZP1
Long gene name:	zona pellucida glycoprotein 1
Synonyms gene name:	zona pellucida glycoprotein 1 (sperm receptor)
Locus:	11q12, 2
Discovery year:	1999-12-10
GenBank acession:	BC067899
Entrez gene record:	22917
Pubmed identfication:	10542331
RefSeq identity:	NM_207341
Classification:	Zona pellucida glycoproteins
Havana BLAST/BLAT:	OTTHUMG00000167797

• #pellucida
• #antibody
• #gene
• #protein
• #antibodies
• #glycoprotein
• #sterile