TCP1 gamma Antibody / CCT3

Contact us
Catalog number: R32392
Price: 406 €
Supplier: NJS poly
Product name: TCP1 gamma Antibody / CCT3
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TCP1 gamma / CCT3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the CCT3 antibody should be determined by the researcher
Intented use: This CCT3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P49368
Purity: Antigen affinity
Description: Alternate transcriptional splice variants have been characterized for this gene, In addition, The complex folds various proteins, The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), This complex consists of two identical stacked rings, Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner, a pseudogene of this gene has been found on chromosome 8, also known as the TCP1 ring complex (TRiC), each containing eight different proteins, including actin and tubulin, T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene
Immunogen: Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CCT3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TCP1 gamma / CCT3
Short name: TCP1 gamma Antibody / CCT3
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: TCP1 g (Antibody to) / CCT3
Alternative technique: antibodies
Identity: 1616
Gene: CCT3 | More about : CCT3
Long gene name: chaperonin containing TCP1 subunit 3
Synonyms gene: TRIC5
Synonyms gene name: chaperonin containing TCP1, subunit 3 (gamma)
Synonyms: Cctg
Locus: 1q22
Discovery year: 1999-02-26
GenBank acession: BC008019
Entrez gene record: 7203
Pubmed identfication: 8110840
RefSeq identity: NM_005998
Classification: Chaperonins
Havana BLAST/BLAT: OTTHUMG00000024061

Related Products :