| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TCP1 gamma / CCT3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the CCT3 antibody should be determined by the researcher |
| Intented use: |
This CCT3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P49368 |
| Purity: |
Antigen affinity |
| Description: |
Alternate transcriptional splice variants have been characterized for this gene, In addition, The complex folds various proteins, The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), This complex consists of two identical stacked rings, Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner, a pseudogene of this gene has been found on chromosome 8, also known as the TCP1 ring complex (TRiC), each containing eight different proteins, including actin and tubulin, T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene |
| Immunogen: |
Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CCT3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TCP1 gamma / CCT3 |
| Short name: |
TCP1 gamma Antibody / CCT3 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
TCP1 g (Antibody to) / CCT3 |
| Alternative technique: |
antibodies |
| Identity: |
1616 |
| Gene: |
CCT3 |
More about : CCT3 |
| Long gene name: |
chaperonin containing TCP1 subunit 3 |
| Synonyms gene: |
TRIC5 |
| Synonyms gene name: |
chaperonin containing TCP1, subunit 3 (gamma) |
| Synonyms: |
Cctg |
| Locus: |
1q22 |
| Discovery year: |
1999-02-26 |
| GenBank acession: |
BC008019 |
| Entrez gene record: |
7203 |
| Pubmed identfication: |
8110840 |
| RefSeq identity: |
NM_005998 |
| Classification: |
Chaperonins |
| Havana BLAST/BLAT: |
OTTHUMG00000024061 |