GAL4 Antibody / Galectin-4

Contact us
Catalog number: R32387
Price: 406 €
Supplier: NJS poly
Product name: GAL4 Antibody / Galectin-4
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GAL4 / Galectin-4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the GAL4 antibody should be determined by the researcher
Intented use: This GAL4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P56470
Purity: Antigen affinity
Description: LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer, The 323-amino acid LGALS4 protein contains 2 homologous, The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions, This gene is mapped to chromosome 19q13, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins, 2 based on an alignment of the LGALS4 sequence, Galectin-4 is a protein that in humans is encoded by the LGALS4 gene
Immunogen: Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GAL4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GAL4 / Galectin-4
Short name: GAL4 Antibody / Galectin-4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: GAL4 (Antibody to) / Galectin-4
Alternative technique: antibodies
Identity: 6565
Gene: LGALS4 | More about : LGALS4
Long gene name: galectin 4
Synonyms gene name: 4 , galactoside-binding, lectin, soluble
Synonyms: GAL4
Locus: 19q13, 2
Discovery year: 1993-08-24
Entrez gene record: 3960
Pubmed identfication: 8063692
RefSeq identity: NM_006149
Classification: Galectins
Havana BLAST/BLAT: OTTHUMG00000182608

Related Products :