| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GAL4 / Galectin-4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the GAL4 antibody should be determined by the researcher |
| Intented use: |
This GAL4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P56470 |
| Purity: |
Antigen affinity |
| Description: |
LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer, The 323-amino acid LGALS4 protein contains 2 homologous, The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions, This gene is mapped to chromosome 19q13, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins, 2 based on an alignment of the LGALS4 sequence, Galectin-4 is a protein that in humans is encoded by the LGALS4 gene |
| Immunogen: |
Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GAL4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GAL4 / Galectin-4 |
| Short name: |
GAL4 Antibody / Galectin-4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
GAL4 (Antibody to) / Galectin-4 |
| Alternative technique: |
antibodies |
| Identity: |
6565 |
| Gene: |
LGALS4 |
More about : LGALS4 |
| Long gene name: |
galectin 4 |
| Synonyms gene name: |
4 , galactoside-binding, lectin, soluble |
| Synonyms: |
GAL4 |
| Locus: |
19q13, 2 |
| Discovery year: |
1993-08-24 |
| Entrez gene record: |
3960 |
| Pubmed identfication: |
8063692 |
| RefSeq identity: |
NM_006149 |
| Classification: |
Galectins |
| Havana BLAST/BLAT: |
OTTHUMG00000182608 |