MUC3 Antibody

Contact us
Catalog number: R32385
Price: 406 €
Supplier: NJS poly
Product name: MUC3 Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MUC3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MUC3 antibody should be determined by the researcher
Intented use: This MUC3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q02505
Purity: Antigen affinity
Description: CREB1, It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E, MUC3A and MUC3B, Peptide stimulation altered expression of a number of transcription factors, The MUC3 gene is mapped to chromosome 7, These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation, and CDX2, coli or enterohemorrhage E, coli serotype O157:H7 to HT-29 human intestinal epithelial cells, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains, including upregulation of SP1, MUC3 consists of two genes
Immunogen: Amino acids DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK from human MUC3A/B were used as the immunogen for the MUC3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MUC3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MUC3
Short name: MUC3 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: MUC3 (Antibody to)
Alternative technique: antibodies
Identity: 7513
Gene: MUC3A | More about : MUC3A
Long gene name: cell surface associated , mucin 3A
Synonyms gene: MUC3
Synonyms gene name: intestinal , mucin 3A
Locus: 7q22, 1
Discovery year: 1990-02-27
GenBank acession: AF113616
Entrez gene record: 4584
Pubmed identfication: 2393399 10973822
RefSeq identity: XM_001725354
Classification: Mucins
Havana BLAST/BLAT: OTTHUMG00000157038

Related Products :