| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MUC3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MUC3 antibody should be determined by the researcher |
| Intented use: |
This MUC3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q02505 |
| Purity: |
Antigen affinity |
| Description: |
CREB1, It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E, MUC3A and MUC3B, Peptide stimulation altered expression of a number of transcription factors, The MUC3 gene is mapped to chromosome 7, These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation, and CDX2, coli or enterohemorrhage E, coli serotype O157:H7 to HT-29 human intestinal epithelial cells, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains, including upregulation of SP1, MUC3 consists of two genes |
| Immunogen: |
Amino acids DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK from human MUC3A/B were used as the immunogen for the MUC3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MUC3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MUC3 |
| Short name: |
MUC3 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
MUC3 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
7513 |
| Gene: |
MUC3A |
More about : MUC3A |
| Long gene name: |
cell surface associated , mucin 3A |
| Synonyms gene: |
MUC3 |
| Synonyms gene name: |
intestinal , mucin 3A |
| Locus: |
7q22, 1 |
| Discovery year: |
1990-02-27 |
| GenBank acession: |
AF113616 |
| Entrez gene record: |
4584 |
| Pubmed identfication: |
2393399 10973822 |
| RefSeq identity: |
XM_001725354 |
| Classification: |
Mucins |
| Havana BLAST/BLAT: |
OTTHUMG00000157038 |