FABP2 Antibody (intestinal)

Contact us
Catalog number: R32378
Price: 406 €
Supplier: NJS poly
Product name: FABP2 Antibody (intestinal)
Quantity: 0.1mg
Other quantities: 0.1mg 389€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: FABP2 (intestinal)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0
Notes: Optimal dilution of the FABP2 antibody should be determined by the researcher
Intented use: This FABP2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P12104
Purity: Antigen affinity
Description: Binds saturated long-chain fatty acids with a high affinity, FABP2 is probably involved in triglyceride-rich lipoprotein synthesis, FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor, [UniProt], but binds with a lower affinity to unsaturated long-chain fatty acids, FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters
Immunogen: Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FABP2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: FABP2 (intestinal)
Short name: FABP2 Antibody (intestinal)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: FABP2 (Antibody to) (intestinal)
Alternative technique: antibodies
Identity: 3556
Gene: FABP2 | More about : FABP2
Long gene name: fatty acid binding protein 2
Synonyms gene name: fatty acid binding protein 2, intestinal
Synonyms: I-FABP
Locus: 4q26
Discovery year: 1986-01-01
GenBank acession: J03465
Entrez gene record: 2169
RefSeq identity: NM_000134
Classification: Fatty acid binding protein family
Havana BLAST/BLAT: OTTHUMG00000132972

Related Products :