| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
FABP2 (intestinal) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the FABP2 antibody should be determined by the researcher |
| Intented use: |
This FABP2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P12104 |
| Purity: |
Antigen affinity |
| Description: |
Binds saturated long-chain fatty acids with a high affinity, FABP2 is probably involved in triglyceride-rich lipoprotein synthesis, FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor, [UniProt], but binds with a lower affinity to unsaturated long-chain fatty acids, FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters |
| Immunogen: |
Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FABP2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
FABP2 (intestinal) |
| Short name: |
FABP2 Antibody (intestinal) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
FABP2 (Antibody to) (intestinal) |
| Alternative technique: |
antibodies |
| Identity: |
3556 |
| Gene: |
FABP2 |
More about : FABP2 |
| Long gene name: |
fatty acid binding protein 2 |
| Synonyms gene name: |
fatty acid binding protein 2, intestinal |
| Synonyms: |
I-FABP |
| Locus: |
4q26 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
J03465 |
| Entrez gene record: |
2169 |
| RefSeq identity: |
NM_000134 |
| Classification: |
Fatty acid binding protein family |
| Havana BLAST/BLAT: |
OTTHUMG00000132972 |