| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Connexin 46 / GJA3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the Connexin 46 antibody should be determined by the researcher |
| Intented use: |
This Connexin 46 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9Y6H8 |
| Purity: |
Antigen affinity |
| Description: |
Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3), One gap junction consists of a cluster of closely packed pairs of transmembrane channels, The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions, This gene is mapped to 13q12, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell, 11, Gap junction alpha-3 protein |
| Immunogen: |
Amino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Connexin 46 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Connexin 46 / GJA3 |
| Short name: |
Connexin 46 Antibody / GJA3 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Connexin 46 (Antibody to) / GJA3 |
| Alternative technique: |
antibodies |
| Identity: |
4277 |
| Gene: |
GJA3 |
More about : GJA3 |
| Long gene name: |
gap junction protein alpha 3 |
| Synonyms gene: |
CZP3 |
| Synonyms gene name: |
46kD (connexin 46) gap junction protein, 46kDa , 46kDa (connexin 46) gap junction protein, alpha 3, alpha 3, alpha 3, gap junction protein |
| Synonyms: |
CX46 |
| Synonyms name: |
connexin 46 |
| Locus: |
13q12, 11 |
| Discovery year: |
1990-02-12 |
| GenBank acession: |
AF075290 |
| Entrez gene record: |
2700 |
| Pubmed identfication: |
10205266 7342922 |
| RefSeq identity: |
NM_021954 |
| Classification: |
Gap junction proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000016510 |