| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
DARPP-32 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the DARPP-32 antibody should be determined by the researcher |
| Intented use: |
This DARPP-32 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9UD71 |
| Purity: |
Antigen affinity |
| Description: |
As a target for dopamine, Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor, Multiple transcript variants encoding different isoforms have been found for this gene, This gene encodes a bifunctional signal transduction molecule, also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene, this gene may serve as a therapeutic target for neurologic and psychiatric disorders, Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) |
| Immunogen: |
Amino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32 were used as the immunogen for the DARPP-32 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DARPP-32 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
minor nuclear, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
DARPP-32 |
| Short name: |
DARPP-32 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
DARPP-32 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
9287 |
| Gene: |
PPP1R1B |
More about : PPP1R1B |
| Long gene name: |
protein phosphatase 1 regulatory inhibitor subunit 1B |
| Synonyms gene name: |
protein phosphatase 1, regulatory (inhibitor) subunit 1B |
| Synonyms: |
DARPP-32 FLJ20940 |
| Synonyms name: |
dopamine and cAMP regulated phosphoprotein |
| Locus: |
17q12 |
| Discovery year: |
1993-01-22 |
| GenBank acession: |
AI124650 |
| Entrez gene record: |
84152 |
| Pubmed identfication: |
8120638 |
| RefSeq identity: |
NM_032192 |
| Classification: |
Protein phosphatase 1 regulatory subunits |
| Havana BLAST/BLAT: |
OTTHUMG00000133210 |