| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PAK7 / PAK5 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PAK5 antibody should be determined by the researcher |
| Intented use: |
This PAK5 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9P286 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants encoding the same protein have been described, And this kinase is predominantly expressed in brain, In addition, It is capable of promoting neurite outgrowth, PAK family members are known to be effectors of Rac/Cdc42 GTPases, The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases, The subcellular localization of this kinase is tightly regulated during cell cycle progression, This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, also known as PAK5, and cell survival signaling, and has been shown to bind CDC42 in the presence of GTP, and thus may play a role in neurite development, is an enzyme that in humans is encoded by the PAK7 gene, proliferation, this kinase is associated with microtubule networks and induces microtubule stabilization, which have been implicated in the regulation of cytoskeletal dynamics, Serine/threonine-protein kinase PAK7 |
| Immunogen: |
Amino acids DPQEQKFTGLPQQWHSLLADTANRPKPMVD of human PAK7/5 were used as the immunogen for the PAK5 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PAK5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PAK7 / PAK5 |
| Short name: |
PAK7 / PAK5 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
p21 protein (Cdc42/Rac)-activated kinase 7 / PAK5 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
PAK7 and IDBG-53557 and ENSG00000101349 and 57144, PAK7 and IDBG-636418 and ENSBTAG00000017679 and 513432, Pak7 and IDBG-207779 and ENSMUSG00000039913 and 241656, nuclei, this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007165 and signal transduction and biological process this GO :0007612 and learning and biological process this GO :0007613 and memory and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008283 and cell proliferation and biological process this GO :0016049 and cell growth and biological process this GO :0016477 and cell migration and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :2001237 and negative regulation of extrinsic apoptotic signaling pathway and biological process, p21 protein (Cdc42/Rac)-activated kinase 7 |
| Identity: |
16061 |
| Gene: |
PAK6 |
More about : PAK6 |
| Long gene name: |
p21 (RAC1) activated kinase 6 |
| Synonyms gene name: |
p21(CDKN1A)-activated kinase 6 p21 protein (Cdc42/Rac)-activated kinase 6 |
| Synonyms: |
PAK5 |
| Locus: |
15q15, 1 |
| Discovery year: |
2001-07-12 |
| GenBank acession: |
AF276893 |
| Entrez gene record: |
56924 |
| Pubmed identfication: |
11278661 |
| Havana BLAST/BLAT: |
OTTHUMG00000129921 |