Otoferlin Antibody

Contact us
Catalog number: R32323
Price: 406 €
Supplier: NJS poly
Product name: Otoferlin Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Otoferlin
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Otoferlin antibody should be determined by the researcher
Intented use: This Otoferlin antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9HC10
Purity: Antigen affinity
Description: DFNB9, Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, Several transcript variants encoding multipleisoforms have been found for this gene, The homology suggests that this protein may be involved in vesicle membrane fusion, The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C, elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains, Otoferlin is a protein that in humans is encoded by the OTOF gene
Immunogen: Amino acids QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ of human OTOF were used as the immunogen for the Otoferlin antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Otoferlin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Otoferlin
Short name: Otoferlin Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Otoferlin (Antibody to)
Alternative technique: antibodies
Identity: 8515
Gene: OTOF | More about : OTOF
Long gene name: otoferlin
Synonyms gene: DFNB9
Synonyms: FER1L2 DFNB6
Synonyms name: fer-1-like family member 2
Locus: 2p23, 3
Discovery year: 1999-03-31
GenBank acession: AF107403
Entrez gene record: 9381
Pubmed identfication: 10192385 18381613
Classification: Ferlin family Deafness associated genes
Havana BLAST/BLAT: OTTHUMG00000096977
Locus Specific Databases: Hereditary Hearing Loss Homepage CCHMC-BMI &, UC Hearing Loss Mutation Database

Related Products :