| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Otoferlin |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Otoferlin antibody should be determined by the researcher |
| Intented use: |
This Otoferlin antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9HC10 |
| Purity: |
Antigen affinity |
| Description: |
DFNB9, Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, Several transcript variants encoding multipleisoforms have been found for this gene, The homology suggests that this protein may be involved in vesicle membrane fusion, The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C, elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains, Otoferlin is a protein that in humans is encoded by the OTOF gene |
| Immunogen: |
Amino acids QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ of human OTOF were used as the immunogen for the Otoferlin antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Otoferlin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Otoferlin |
| Short name: |
Otoferlin Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Otoferlin (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
8515 |
| Gene: |
OTOF |
More about : OTOF |
| Long gene name: |
otoferlin |
| Synonyms gene: |
DFNB9 |
| Synonyms: |
FER1L2 DFNB6 |
| Synonyms name: |
fer-1-like family member 2 |
| Locus: |
2p23, 3 |
| Discovery year: |
1999-03-31 |
| GenBank acession: |
AF107403 |
| Entrez gene record: |
9381 |
| Pubmed identfication: |
10192385 18381613 |
| Classification: |
Ferlin family Deafness associated genes |
| Havana BLAST/BLAT: |
OTTHUMG00000096977 |
| Locus Specific Databases: |
Hereditary Hearing Loss Homepage CCHMC-BMI &, UC Hearing Loss Mutation Database |