VRK1 Antibody

Catalog number:	R32317 Buy Now
Price:	489 €
Supplier:	Bioss Polyclonal Antibodies
Product name:	VRK1 Antibody
Quantity:	100 microliters
Other quantities:	0.1ml 263€ 100ul 426€
Related search:	vrk antibody gene antibodies this identity

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	VRK1
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	1-0, 5ug/ml, Western blot: 0
Notes:	Optimal dilution of the VRK1 antibody should be determined by the researcher
Intented use:	This VRK1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	Q99986
Purity:	Antigen affinity
Description:	It is widely expressed in human tissues and has increased expression in actively dividing cells, Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, This gene, This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases, This protein also phosphorylates histone, and carcinomas, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN, casein, fetal liver, in vitro, may regulate cell proliferation, such as those in testis, therefore, thymus, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination, Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene
Immunogen:	Amino acids EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK of human VRK1 were used as the immunogen for the VRK1 antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the VRK1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	VRK1
Short name:	VRK1 Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	VRK1 (Antibody to)
Alternative technique:	antibodies
Identity:	12718
Gene:	VRK1 | More about : VRK1
Long gene name:	vaccinia related kinase 1
Locus:	14q32, 2
Discovery year:	1997-06-12
GenBank acession:	AB000449
Entrez gene record:	7443
Pubmed identfication:	9344656
RefSeq identity:	NM_003384
Havana BLAST/BLAT:	OTTHUMG00000171459

• #vrk
• #antibody
• #gene
• #antibodies
• #this
• #identity