Neuroserpin Antibody / SERPINI1

Contact us
Catalog number: R32312
Price: 406 €
Supplier: NJS poly
Product name: Neuroserpin Antibody / SERPINI1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Neuroserpin / SERPINI1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the Neuroserpin antibody should be determined by the researcher
Intented use: This Neuroserpin antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q99574
Purity: Antigen affinity
Description: It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity, Multiple alternatively spliced variants, Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), The protein is primarily secreted by axons in the brain, This gene encodes a member of the serpin superfamily of serine proteinase inhibitors, and preferentially reacts with and inhibits tissue-type plasminogen activator, encoding the same protein, have been identified, which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers, Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene
Immunogen: Amino acids KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L of human Neuroserpin/SERPINI1 were used as the immunogen for the Neuroserpin antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Neuroserpin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Neuroserpin / SERPINI1
Short name: Neuroserpin Antibody / SERPINI1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: clade I (neuroserpin), member 1, Neuroserpin (Antibody to) / serpin peptidase inhibitor
Alternative technique: antibodies
Alternative to gene target: BT, Extracellular, SERPINI1 and IDBG-64026 and ENSG00000163536 and 5274, Serpini1 and IDBG-152513 and ENSMUSG00000027834 and 20713, clade I (neuroserpin), member 1, neuroserpin and PI12, serine-type endopeptidase inhibitor activity, this GO :0004867 and serine-type endopeptidase inhibitor activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0007417 and central nervous system development and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008219 and cell death and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0030155 and regulation of cell adhesion and biological process this GO :0030162 and regulation of proteolysis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004867 : serine-type endopeptidase inhibitor activity, this GO :0004867 : serine-type endopeptidase inhibitor activity, 19231 and IDBG-636831 and ENSBTAG00000012708 and 509976, serpin peptidase inhibitor
Identity: 8943
Gene: SERPINI1 | More about : SERPINI1
Long gene name: serpin family I member 1
Synonyms gene: PI12
Synonyms gene name: clade I (neuroserpin), clade I (neuroserpin), member 1 , member 1 serpin peptidase inhibitor, serine (or cysteine) proteinase inhibitor
Synonyms: neuroserpin
Locus: 3q26, 1
Discovery year: 1995-12-20
GenBank acession: Z81326
Entrez gene record: 5274
Pubmed identfication: 24172014
Classification: Serpin peptidase inhibitors
Havana BLAST/BLAT: OTTHUMG00000158450

Related Products :