KIM-1 Antibody / TIM-1 / HAVCR1

Contact us
Catalog number: R32305
Price: 485 €
Supplier: acr
Product name: KIM-1 Antibody / TIM-1 / HAVCR1
Quantity: 0,1 mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: KIM-1 / TIM-1 / HAVCR1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the KIM1 antibody should be determined by the researcher
Intented use: This KIM1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q96D42
Purity: Antigen affinity
Description: HAVCR or TIM1, It may play a role in T-helper cell development and the regulation of asthma and allergic diseases, May play a role in kidney injury and repair, Receptor for TIMD4 (By similarity), [UniProt], also known as HAVCR1, is a protein that in humans is encoded by the HAVCR1 gene, Kidney injury molecule 1
Immunogen: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KIM1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: KIM-1 / TIM-1 / HAVCR1
Short name: KIM-1 Antibody / TIM-1 / HAVCR1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: KIM-1 (Antibody to) / TIM-1 / hepatitis A virus cellular receptor 1
Alternative technique: antibodies
Alternative to gene target: HAVCR1 and IDBG-55259 and ENSG00000113249 and 26762, Plasma membranes, protein binding, this GO :0001618 and virus receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, hepatitis A virus cellular receptor 1
Identity: 17866
Gene: HAVCR1 | More about : HAVCR1
Long gene name: hepatitis A virus cellular receptor 1
Synonyms: HAVCR-1 TIM-1 TIM1 HAVCR TIMD1 CD365 KIM1
Synonyms name: T-cell immunoglobulin mucin family member 1 kidney injury molecule 1
Locus: 5q33, 3
Discovery year: 2002-12-04
GenBank acession: AF043724
Entrez gene record: 26762
Pubmed identfication: 9658108 11725301 18273441
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000163466

Related Products :

R32305 KIM-1 Antibody / TIM-1 / HAVCR1 0.1mg 406 € NJS poly human
MBS241886 Anti-Human HAVCR1 / KIM-1 50ug 597 € MBS Polyclonals_1 human
MBS242060 Anti-Human HAVCR1 / KIM-1 50ug 597 € MBS Polyclonals_1 human
MBS241834 PAb (IgG) to Human HAVCR1 / KIM-1 50ug 597 € MBS Polyclonals_1 human
RP-3023C Recombinant Canine KIM-1 / TIM1 / HAVCR1 Protein (His Tag) 50μg 659 € adv human
RP-0957H Recombinant Human KIM-1 / TIM1 / HAVCR1 Protein 50μg 624 € adv human
RP-0956H Recombinant Human KIM-1 / TIM1 / HAVCR1 Protein (aa 1-135, His Tag) 50μg 659 € adv human
RP-0955H Recombinant Human KIM-1 / TIM1 / HAVCR1 Protein (His & Fc Tag) 50μg 659 € adv human
RP-1377M Recombinant Mouse KIM-1 / TIM1 / HAVCR1 Protein (His & Fc Tag) 50μg 659 € adv mouse
RP-1378M Recombinant Mouse KIM-1 / TIM1 / HAVCR1 Protein (His Tag) 50μg 624 € adv mouse
R30715 TIM-1 Antibody (KIM-1) 0.1mg 389 € NJS poly human
MBS560691 Affinity Purifed anti-Human KIM-1/HAVCR/TIM-1 100ug 343 € MBS Polyclonals_1 human
MBS560365 Affinity Purified Goat anti-Rat KIM-1/HAVCR/TIM-1 100ug 370 € MBS Polyclonals_1 rat
GENTAUR-58bcb95644e19 Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-17 (tim-17) 1000ug 1453 € MBS Recombinant Proteins human
GENTAUR-58bcb95692ba9 Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-17 (tim-17) 1000ug 1962 € MBS Recombinant Proteins human
GWB-69EEFE Hepatitis A Virus Cellular Receptor 1 (HAVCR-1) (HAVCR1) Rabbit antibody to or anti-Human Polyclonal (aa200-300) antibody 1 tube 602 € genways human
GWB-6F8736 Hepatitis A Virus Cellular Receptor 1 (HAVCR-1) (HAVCR1) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 tube 602 € genways human
GWB-858461 Hepatitis A Virus Cellular Receptor 1 (HAVCR-1) (HAVCR1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 602 € genways human
GENTAUR-58be19faef4ef Kidney Injury Molecule-1 (KIM-1) Antibody 1000ug 625 € MBS mono human
GENTAUR-58be1a07d575a Kidney Injury Molecule-1 (KIM-1) Antibody 1000ug 625 € MBS mono human
R30706 KIM-1 Antibody 0.1mg 389 € NJS poly human
R36185-100UG KIM-1 Antibody 0.1mg 406 € NJS poly human
GENTAUR-58bdf008d637b Anti- HAVCR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf00965c29 Anti- HAVCR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf028a9c84 Anti- HAVCR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf02924e47 Anti- HAVCR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be442d158c0 Anti- HAVCR1 Antibody 100ug 393 € MBS Polyclonals human
AP08438PU-N anti-TIMD1 / HAVCR1 (200-300) Antibody 50 Вµg 732 € acr human
AR51854PU-N anti-TIMD1 / HAVCR1 (21-295, His-tag) Antibody 0,5 mg 1109 € acr human
AR51854PU-S anti-TIMD1 / HAVCR1 (21-295, His-tag) Antibody 0,1 mg 485 € acr human