| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
KIM-1 / TIM-1 / HAVCR1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the KIM1 antibody should be determined by the researcher |
| Intented use: |
This KIM1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q96D42 |
| Purity: |
Antigen affinity |
| Description: |
HAVCR or TIM1, It may play a role in T-helper cell development and the regulation of asthma and allergic diseases, May play a role in kidney injury and repair, Receptor for TIMD4 (By similarity), [UniProt], also known as HAVCR1, is a protein that in humans is encoded by the HAVCR1 gene, Kidney injury molecule 1 |
| Immunogen: |
Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KIM1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
KIM-1 / TIM-1 / HAVCR1 |
| Short name: |
KIM-1 Antibody / TIM-1 / HAVCR1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
KIM-1 (Antibody to) / TIM-1 / hepatitis A virus cellular receptor 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
HAVCR1 and IDBG-55259 and ENSG00000113249 and 26762, Plasma membranes, protein binding, this GO :0001618 and virus receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, hepatitis A virus cellular receptor 1 |
| Identity: |
17866 |
| Gene: |
HAVCR1 |
More about : HAVCR1 |
| Long gene name: |
hepatitis A virus cellular receptor 1 |
| Synonyms: |
HAVCR-1 TIM-1 TIM1 HAVCR TIMD1 CD365 KIM1 |
| Synonyms name: |
T-cell immunoglobulin mucin family member 1 kidney injury molecule 1 |
| Locus: |
5q33, 3 |
| Discovery year: |
2002-12-04 |
| GenBank acession: |
AF043724 |
| Entrez gene record: |
26762 |
| Pubmed identfication: |
9658108 11725301 18273441 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000163466 |