| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
CPT1B |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the CPT1B antibody should be determined by the researcher |
| Intented use: |
This CPT1B antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q92523 |
| Purity: |
Antigen affinity |
| Description: |
Multiple transcript variants encoding different isoforms have been found for this gene, The protein encoded by this gene, This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria, a member of the carnitine/ choline acetyltransferase family, and read-through transcripts are expressed from the upstream locus that include exons from this gene, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria, 33, CPT1B is located on 22q13 |
| Immunogen: |
Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CPT1B antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
CPT1B |
| Short name: |
CPT1B Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
CPT1B (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
2329 |
| Gene: |
CPT1B |
More about : CPT1B |
| Long gene name: |
carnitine palmitoyltransferase 1B |
| Synonyms gene name: |
carnitine palmitoyltransferase 1B (muscle) |
| Synonyms: |
M-CPT1 CPT1-M |
| Synonyms name: |
carnitine O-palmitoyltransferase 1B |
| Locus: |
22q13, 33 |
| Discovery year: |
1996-08-14 |
| GenBank acession: |
U62733 |
| Entrez gene record: |
1375 |
| Pubmed identfication: |
9070950 |
| RefSeq identity: |
NM_152246 |
| Havana BLAST/BLAT: |
OTTHUMG00000137390 |