CPT1B Antibody

Contact us
Catalog number: R32293
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: CPT1B Antibody
Quantity: 0.1ml
Other quantities: 0.08 ml 199€ 0.1mg 406€ 0.1ml 263€ 0.4 ml 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: CPT1B
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the CPT1B antibody should be determined by the researcher
Intented use: This CPT1B antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q92523
Purity: Antigen affinity
Description: Multiple transcript variants encoding different isoforms have been found for this gene, The protein encoded by this gene, This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria, a member of the carnitine/ choline acetyltransferase family, and read-through transcripts are expressed from the upstream locus that include exons from this gene, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria, 33, CPT1B is located on 22q13
Immunogen: Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CPT1B antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: CPT1B
Short name: CPT1B Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: CPT1B (Antibody to)
Alternative technique: antibodies
Identity: 2329
Gene: CPT1B | More about : CPT1B
Long gene name: carnitine palmitoyltransferase 1B
Synonyms gene name: carnitine palmitoyltransferase 1B (muscle)
Synonyms: M-CPT1 CPT1-M
Synonyms name: carnitine O-palmitoyltransferase 1B
Locus: 22q13, 33
Discovery year: 1996-08-14
GenBank acession: U62733
Entrez gene record: 1375
Pubmed identfication: 9070950
RefSeq identity: NM_152246
Havana BLAST/BLAT: OTTHUMG00000137390

Related Products :

A01C0438 anti-CPT1B Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58be309fa75a9 Anti- CPT1B Antibody 50ug 724 € MBS Polyclonals human
GENTAUR-58be526e72bc9 Anti- CPT1B Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58be526ee046a Anti- CPT1B Antibody 0.2 mg 663 € MBS Polyclonals human
abx148913 Anti-CPT1B Antibody inquire 50 € abbex human
AP22530PU-N anti-CPT1B / CPT1-M (760-772) Antibody 50 Вµg 732 € acr human
CPA4379-100ul anti-CPT1B / CPT1-M Antibody 0,1 ml 442 € acr human
CPA4379-200ul anti-CPT1B / CPT1-M Antibody 0,2 ml 688 € acr human
CPA4379-30ul anti-CPT1B / CPT1-M Antibody 30 Вµl 326 € acr human
AP12255PU-N anti-CPT1B / CPT1-M (C-term) Antibody 0,4 ml 587 € acr human
AP51063PU-N anti-CPT1B / CPT1-M (C-term) Antibody 0,4 ml 587 € acr human
F44997-0.08ML CPT1B Antibody 0.08 ml 199 € NJS poly human
F44997-0.4ML CPT1B Antibody 0.4 ml 406 € NJS poly human
F48089-0.08ML CPT1B Antibody 0.08 ml 199 € NJS poly human
F48089-0.4ML CPT1B Antibody 0.4 ml 406 € NJS poly human
GWB-MQ462C CPT1B antibody 1 vial 521 € genways human
R32293 CPT1B Antibody 0.1mg 406 € NJS poly human
R33478-100UG CPT1B Antibody 0.1mg 406 € NJS poly human
bs-5045R-A350 CPT1B Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5045R-A488 CPT1B Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5045R-A555 CPT1B Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5045R-A594 CPT1B Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5045R-A647 CPT1B Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5045R-Biotin CPT1B Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-5045R CPT1B Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-5045R-Cy3 CPT1B Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5045R-Cy5 CPT1B Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5045R-Cy5.5 CPT1B Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5045R-Cy7 CPT1B Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5045R-FITC CPT1B Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human