UBE2Q2 Antibody

Contact us
Catalog number: R32289
Price: 406 €
Supplier: NJS poly
Product name: UBE2Q2 Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: UBE2Q2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the UBE2Q2 antibody should be determined by the researcher
Intented use: This UBE2Q2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q8WVN8
Purity: Antigen affinity
Description: Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, Finally, Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs), It can covalently bind ubiquitin on the active site cysteine within the UBC domain, Its gene is mapped to 15q24, Moreover, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint, 2, UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins
Immunogen: Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UBE2Q2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: UBE2Q2
Short name: UBE2Q2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: UBE2Q2 (Antibody to)
Alternative technique: antibodies
Identity: 19248
Gene: UBE2Q2 | More about : UBE2Q2
Long gene name: ubiquitin conjugating enzyme E2 Q2
Synonyms gene name: ubiquitin-conjugating enzyme E2Q (putative) 2 ubiquitin-conjugating enzyme E2Q family member 2
Synonyms: DKFZp762C143
Locus: 15q24, 2
Discovery year: 2005-10-04
GenBank acession: BC017708
Entrez gene record: 92912
Pubmed identfication: 16300736
RefSeq identity: NM_173469
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000142839

Related Products :