UBE1C Antibody / UBA3

Contact us
Catalog number: R32284
Price: 406 €
Supplier: NJS poly
Product name: UBE1C Antibody / UBA3
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: UBE1C / UBA3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the UBE1C antibody should be determined by the researcher
Intented use: This UBE1C antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q8TBC4
Purity: Antigen affinity
Description: Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, The encoded enzyme associates with AppBp1, The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation, This gene encodes a member of the E1 ubiquitin-activating enzyme family, Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, an amyloid beta precursor protein binding protein, an ubiquitin-like protein, and then the enzyme complex activates NEDD8, and ubiquitin-protein ligases, or E1s, or E2s, or E3s, signaling and embryogenesis, to form a heterodimer, ubiquitin-conjugating enzymes, which regulates cell division, NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene
Immunogen: Amino acids KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD of human UBE1C/UBA3 were used as the immunogen for the UBE1C antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UBE1C antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: UBE1C / UBA3
Short name: UBE1C Antibody / UBA3
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: UBE1C (Antibody to) / UBA3
Alternative technique: antibodies
Identity: 12470
Gene: UBA3 | More about : UBA3
Long gene name: ubiquitin like modifier activating enzyme 3
Synonyms gene: UBE1C
Synonyms gene name: ubiquitin-activating enzyme E1C (homologous to yeast UBA3) ubiquitin-activating enzyme E1C (UBA3 homolog, yeast) ubiquitin-like modifier activating enzyme 3
Synonyms: hUba3 NAE2
Synonyms name: NEDD8-activating enzyme E1 catalytic subunit NEDD8-activating enzyme E1 subunit 2
Locus: 3p14, 1
Discovery year: 1999-01-22
GenBank acession: AB012190
Entrez gene record: 9039
Pubmed identfication: 9694792
RefSeq identity: NM_198195
Classification: Ubiquitin like modifier activating enzymes
Havana BLAST/BLAT: OTTHUMG00000154325

Related Products :