| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
UBE1C / UBA3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the UBE1C antibody should be determined by the researcher |
| Intented use: |
This UBE1C antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q8TBC4 |
| Purity: |
Antigen affinity |
| Description: |
Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, The encoded enzyme associates with AppBp1, The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation, This gene encodes a member of the E1 ubiquitin-activating enzyme family, Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, an amyloid beta precursor protein binding protein, an ubiquitin-like protein, and then the enzyme complex activates NEDD8, and ubiquitin-protein ligases, or E1s, or E2s, or E3s, signaling and embryogenesis, to form a heterodimer, ubiquitin-conjugating enzymes, which regulates cell division, NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene |
| Immunogen: |
Amino acids KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD of human UBE1C/UBA3 were used as the immunogen for the UBE1C antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UBE1C antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
UBE1C / UBA3 |
| Short name: |
UBE1C Antibody / UBA3 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
UBE1C (Antibody to) / UBA3 |
| Alternative technique: |
antibodies |
| Identity: |
12470 |
| Gene: |
UBA3 |
More about : UBA3 |
| Long gene name: |
ubiquitin like modifier activating enzyme 3 |
| Synonyms gene: |
UBE1C |
| Synonyms gene name: |
ubiquitin-activating enzyme E1C (homologous to yeast UBA3) ubiquitin-activating enzyme E1C (UBA3 homolog, yeast) ubiquitin-like modifier activating enzyme 3 |
| Synonyms: |
hUba3 NAE2 |
| Synonyms name: |
NEDD8-activating enzyme E1 catalytic subunit NEDD8-activating enzyme E1 subunit 2 |
| Locus: |
3p14, 1 |
| Discovery year: |
1999-01-22 |
| GenBank acession: |
AB012190 |
| Entrez gene record: |
9039 |
| Pubmed identfication: |
9694792 |
| RefSeq identity: |
NM_198195 |
| Classification: |
Ubiquitin like modifier activating enzymes |
| Havana BLAST/BLAT: |
OTTHUMG00000154325 |