MGA Antibody

Contact us
Catalog number: R32278
Price: 406 €
Supplier: NJS poly
Product name: MGA Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MGA
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MGA antibody should be determined by the researcher
Intented use: This MGA antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q8IWI9
Purity: Antigen affinity
Description: Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells, EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG, Expression of Mga with Max, GAS) in response to changing environmental conditions, It had been found that the mouse transcription factor Max interacted with Mga, Mga repressed transcription of a reporter driven from a T-box-binding site, The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max, activated transcription from a reporter containing the E-box site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site, but not Mga alone, Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus
Immunogen: Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MGA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MGA
Short name: MGA Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: MGA (Antibody to)
Alternative technique: antibodies
Identity: 7043
Gene: MGAM | More about : MGAM
Long gene name: maltase-glucoamylase
Synonyms: MGA
Synonyms name: alpha-glucosidase
Locus: 7q34
Discovery year: 1999-09-07
GenBank acession: AF016833
Entrez gene record: 8972
Pubmed identfication: 9446624
Havana BLAST/BLAT: OTTHUMG00000158395

Related Products :