| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MGA |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MGA antibody should be determined by the researcher |
| Intented use: |
This MGA antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q8IWI9 |
| Purity: |
Antigen affinity |
| Description: |
Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells, EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG, Expression of Mga with Max, GAS) in response to changing environmental conditions, It had been found that the mouse transcription factor Max interacted with Mga, Mga repressed transcription of a reporter driven from a T-box-binding site, The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max, activated transcription from a reporter containing the E-box site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site, but not Mga alone, Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus |
| Immunogen: |
Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MGA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MGA |
| Short name: |
MGA Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
MGA (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
7043 |
| Gene: |
MGAM |
More about : MGAM |
| Long gene name: |
maltase-glucoamylase |
| Synonyms: |
MGA |
| Synonyms name: |
alpha-glucosidase |
| Locus: |
7q34 |
| Discovery year: |
1999-09-07 |
| GenBank acession: |
AF016833 |
| Entrez gene record: |
8972 |
| Pubmed identfication: |
9446624 |
| Havana BLAST/BLAT: |
OTTHUMG00000158395 |