ARC Antibody / Activity-regulated cytoskeleton-associated protein

Contact us
Catalog number: R32271
Price: 608 €
Supplier: MBS Polyclonals_1
Product name: ARC Antibody / Activity-regulated cytoskeleton-associated protein
Quantity: 100ul
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ARC / Activity-regulated cytoskeleton-associated protein
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the ARC antibody should be determined by the researcher
Intented use: This ARC antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q7LC44
Purity: Antigen affinity
Description: Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience
Immunogen: Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ARC antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ARC / Activity-regulated cytoskeleton-associated protein
Short name: ARC Antibody / Activity-regulated cytoskeleton-associated protein
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: activity-regulated cytoskeleton-associated protein (Antibody to) / Activity-regulated cytoskeleton-associated protein
Alternative technique: antibodies
Alternative to gene target: ARC and IDBG-37634 and ENSG00000198576 and 23237, ARC and IDBG-648018 and ENSBTAG00000021639 and 519403, Arc and IDBG-149967 and ENSMUSG00000022602 and 11838, Arg3, Cell surfaces, protein binding, this GO :0001669 and acrosomal vesicle and cellular component this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006897 and endocytosis and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007492 and endoderm development and biological process this GO :0007612 and learning and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0014069 and postsynaptic density and cellular component this GO :0015629 and actin cytoskeleton and cellular component this GO :0016477 and cell migration and biological process this GO :0022604 and regulation of cell morphogenesis and biological process this GO :0030054 and cell junction and cellular component this GO :0043197 and dendritic spine and cellular component this GO :0045211 and postsynaptic membrane and cellular component this GO :0048168 and regulation of neuronal synaptic plasticity and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, 1, activity-regulated cytoskeleton-associated protein
Identity: 648
Gene: ARC | More about : ARC
Long gene name: activity regulated cytoskeleton associated protein
Synonyms: KIAA0278 Arg3, 1
Locus: 8q24, 3
Discovery year: 2000-05-23
GenBank acession: AF193421
Entrez gene record: 23237
Pubmed identfication: 10970730 17466953
Havana BLAST/BLAT: OTTHUMG00000134310

Related Products :

MBS618426 Arg3.1 (Activity-regulated Cytoskeleton-associated Protein, Activity-regulated Gene 3.1 Protein Homolog, ARG3.1/ARC, ARC/ARG3.1) Antibody 100ul 652 € MBS Polyclonals_1 human
GWB-E416FF Activity-regulated Cytoskeleton-associated protein (ARC) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 648 € genways human
GENTAUR-58bdca9cc6f66 Anti- Activity Regulated Cytoskeleton Associated Protein (ARC) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdca9d30224 Anti- Activity Regulated Cytoskeleton Associated Protein (ARC) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd286c0c9c Anti- Activity Regulated Cytoskeleton Associated Protein (ARC) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bddccb49af5 Anti- Activity Regulated Cytoskeleton Associated Protein (ARC) Antibody 100ug 564 € MBS Polyclonals human
R32271 ARC Antibody / Activity-regulated cytoskeleton-associated protein 0.1mg 406 € NJS poly human
EKU02119 Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU02120 Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
AE55869RA-48 ELISA test for Rat Activity-regulated cytoskeleton-associated protein (ARC) 1x plate of 48 wells 373 € abebio rat
DL-ARC-Mu Mouse Activity Regulated Cytoskeleton Associated Protein ARC ELISA Kit 96T 921 € DL elisas mouse
AE55869RA-96 Rat Activity-regulated cytoskeleton-associated protein (ARC) ELISA Kit 1x plate of 96 wells 612 € abebio rat
DL-ARC-Ra Rat Activity Regulated Cytoskeleton Associated Protein ARC ELISA Kit 96T 962 € DL elisas rat
MBS613469 Arg3.1 (ARC, Growth factor ARC, NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone 630103O07 product activity regulated cytoskeletal-associated protein, full insert sequence, 9.5 days embryo parthenogenote cDNA, RIKEN fu Antibody 500ug 652 € MBS Polyclonals_1 human
abx167973 Anti-Activity Regulated Cytoskeleton Associated Protein (Recombinant) 100 μg 905 € abbex human
abx263342 Anti-Activity-Regulated Cytoskeleton-Associated Protein (Recombinant) 1 µg 238 € abbex human
abx251729 Anti-Human Activity-regulated cytoskeleton-associated protein ELISA Kit 96 tests 659 € abbex human
MBS622973 RAMP1 (Receptor Activity Modifying Protein1, Receptor Activity Modifying Protein 1 [Precursor], Receptor (G Protein-coupled) Activity Modifying Protein 1, Calcitonin Receptor-like Receptor Activity Modifying Protein 1, CRLR Activity Modifying Protein 1) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS624139 Actin Related Protein 2/3 Complex, Subunit 1B, 41kD (ARP2/3 Subunit 1B, ARPC1B, ARC41, p40-ARC, p41-ARC, ARP2/3 Protein Complex Subunit p41) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623257 ARP2-3 (Actin Related Protein 2/3 Complex, Subunit 1B, 41kD (ARP2/3 Subunit 1B, ARPC1B, ARC41, p40-ARC, p41-ARC, ARP2/3 Protein Complex Subunit p41) Antibody 100ug 707 € MBS Polyclonals_1 human
GENTAUR-58b8823d52a96 Enterobacteria phage P22 Transcriptional repressor arc (arc) 100ug 1243 € MBS Recombinant Proteins human
GENTAUR-58b8823db2ba8 Enterobacteria phage P22 Transcriptional repressor arc (arc) 1000ug 1243 € MBS Recombinant Proteins human
GENTAUR-58b8823e3eb8e Enterobacteria phage P22 Transcriptional repressor arc (arc) 100ug 1752 € MBS Recombinant Proteins human
GENTAUR-58b8823e9b5b5 Enterobacteria phage P22 Transcriptional repressor arc (arc) 1000ug 1752 € MBS Recombinant Proteins human
MBS622875 TORC2 (TORC 2, TORC-2, Transducer of Regulated CREB Protein 2, CREB-regulated Transcription Coactivator 2, CRTC2, Transducer of Regulated cAMP Response Element-binding Protein) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS622089 BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, BAP2, Fas Ligand-associated Factor 3, FLAF3, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSP53, Ins Antibody 100ug 763 € MBS Polyclonals_1 human
MBS611974 ADNP (ADNP, activity-dependent neuroprotector (activity dependent neuroprotective protein), KIAA0784) Antibody 100ul 857 € MBS Polyclonals_1 human
GWB-AXR201 HAT Activity Activity Assay Kit 1 vial 678 € genways human
GWB-AXR202 SOD Activity Activity Assay Kit 1 vial 516 € genways human
MBS616087 CKAP-5 (Cytoskeleton associated protein 5, ch-TOG, Ch-TOG protein, Colonic and hepatic tumor over-expressed protein, FLJ35359, KIAA0097, TOG) Antibody 100ul 608 € MBS Polyclonals_1 human