| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Sp5 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Sp5 antibody should be determined by the researcher |
| Intented use: |
This Sp5 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q6BEB4 |
| Purity: |
Antigen affinity |
| Description: |
Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, It is a member of the Sp family of zinc finger transcription factors, Like other family members, gastric cancer and colon cancer, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus, 1, Sp5 is mapped to 2q31 |
| Immunogen: |
Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Sp5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Sp5 |
| Short name: |
Sp5 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Sp5 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
14529 |
| Gene: |
SP5 |
More about : SP5 |
| Long gene name: |
Sp5 transcription factor |
| Locus: |
2q31, 1 |
| Discovery year: |
2004-06-09 |
| Entrez gene record: |
389058 |
| RefSeq identity: |
XM_371581 |
| Classification: |
Sp transcription factors Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000154053 |