Sp5 Antibody

Contact us
Catalog number: R32265
Price: 406 €
Supplier: NJS poly
Product name: Sp5 Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Sp5
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Sp5 antibody should be determined by the researcher
Intented use: This Sp5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q6BEB4
Purity: Antigen affinity
Description: Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, It is a member of the Sp family of zinc finger transcription factors, Like other family members, gastric cancer and colon cancer, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus, 1, Sp5 is mapped to 2q31
Immunogen: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Sp5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Sp5
Short name: Sp5 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Sp5 (Antibody to)
Alternative technique: antibodies
Identity: 14529
Gene: SP5 | More about : SP5
Long gene name: Sp5 transcription factor
Locus: 2q31, 1
Discovery year: 2004-06-09
Entrez gene record: 389058
RefSeq identity: XM_371581
Classification: Sp transcription factors Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000154053

Related Products :