Srb1 Antibody

Contact us
Catalog number: R32260
Price: 406 €
Supplier: NJS poly
Product name: Srb1 Antibody
Quantity: 0.1mg
Other quantities: 0.1mg 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Srb1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the Srb1 antibody should be determined by the researcher
Intented use: This Srb1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q61009
Purity: Antigen affinity
Description: It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver, SR-BI functions as a receptor for high-density lipoprotein, SR-BI has also been identified in the livers of non-mammalian species (turtle, Scavenger receptor class B, The turtle also seems to upregulate SB-RI during egg development, This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion, also known as SR-BI, and skate), chicken, frog, goldfish, including the liver and adrenal, indicating that cholesterol efflux may be at peak levels during developmental stages, is a protein that in humans is encoded by the SCARB1 gene, shark, suggesting it emerged early in vertebrate evolutionary history, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, which is the principal cause of heart disease and stroke, Scavenger receptor class B member 1 (SRB1)
Immunogen: Amino acids KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL of mouse Srb1 were used as the immunogen for the Srb1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Srb1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Srb1
Short name: Srb1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Srb1 (Antibody to)
Alternative technique: antibodies
Identity: 1664
Gene: SCARB1 | More about : SCARB1
Long gene name: scavenger receptor class B member 1
Synonyms gene: CD36L1
Synonyms gene name: CD36 antigen (collagen type I receptor, member 1 , thrombospondin receptor)-like 1 scavenger receptor class B
Synonyms: SRB1 CLA-1 CLA1 SR-BI
Locus: 12q24, 31
Discovery year: 1994-09-06
GenBank acession: Z22555
Entrez gene record: 949
Pubmed identfication: 7689561
RefSeq identity: NM_005505
Classification: Scavenger receptors
Havana BLAST/BLAT: OTTHUMG00000168544

Related Products :