| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Srb1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the Srb1 antibody should be determined by the researcher |
| Intented use: |
This Srb1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q61009 |
| Purity: |
Antigen affinity |
| Description: |
It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver, SR-BI functions as a receptor for high-density lipoprotein, SR-BI has also been identified in the livers of non-mammalian species (turtle, Scavenger receptor class B, The turtle also seems to upregulate SB-RI during egg development, This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion, also known as SR-BI, and skate), chicken, frog, goldfish, including the liver and adrenal, indicating that cholesterol efflux may be at peak levels during developmental stages, is a protein that in humans is encoded by the SCARB1 gene, shark, suggesting it emerged early in vertebrate evolutionary history, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, which is the principal cause of heart disease and stroke, Scavenger receptor class B member 1 (SRB1) |
| Immunogen: |
Amino acids KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL of mouse Srb1 were used as the immunogen for the Srb1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Srb1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Srb1 |
| Short name: |
Srb1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Srb1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
1664 |
| Gene: |
SCARB1 |
More about : SCARB1 |
| Long gene name: |
scavenger receptor class B member 1 |
| Synonyms gene: |
CD36L1 |
| Synonyms gene name: |
CD36 antigen (collagen type I receptor, member 1 , thrombospondin receptor)-like 1 scavenger receptor class B |
| Synonyms: |
SRB1 CLA-1 CLA1 SR-BI |
| Locus: |
12q24, 31 |
| Discovery year: |
1994-09-06 |
| GenBank acession: |
Z22555 |
| Entrez gene record: |
949 |
| Pubmed identfication: |
7689561 |
| RefSeq identity: |
NM_005505 |
| Classification: |
Scavenger receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000168544 |