MICA Antibody

Contact us
Catalog number: R32255
Price: 263 €
Supplier: Bioss Primary Unconjugated Antibodies
Product name: MICA Antibody
Quantity: 0.1ml
Other quantities: 0.08 ml 199€ 0.1ml 263€ 0.4 ml 406€ 1 vial 411€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MICA
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MICA antibody should be determined by the researcher
Intented use: This MICA antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q29983
Purity: Antigen affinity
Description: Alternative splicing of this gene results in multiple transcript variants, And the protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, It is a ligand for the NKG2-D type II integral membrane protein receptor, The protein product is expressed on the cell surface, Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma, This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A
Immunogen: Amino acids QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK of human MICA were used as the immunogen for the MICA antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MICA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MICA
Short name: MICA Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Major histocompabitility complex class I polypeptide-related sequence A (Antibody to)
Alternative technique: antibodies
Alternative to gene target: MICA and IDBG-77578 and ENSG00000204520 and 100507436, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006955 and immune response and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0045087 and innate immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, MHC class I polypeptide-related sequence A
Identity: 7090
Gene: MICA | More about : MICA
Long gene name: MHC class I polypeptide-related sequence A
Synonyms: PERB11, 1
Locus: 6p21, 33
Discovery year: 1994-05-16
GenBank acession: L14848
Entrez gene record: 100507436
Pubmed identfication: 8022771
RefSeq identity: NM_001177519
Classification: C1-set domain containing
Havana BLAST/BLAT: OTTHUMG00000031073
Locus Specific Databases: IMGT/HLA Database

Related Products :

GWB-5D823B Mhc Class I-related protein (MICA) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 tube 602 € genways human
BB-EK0812 anti-Human MICA ELISA Kit Antibody 96 Tests 761 € acr human
CEK1268 anti-Human MICA ELISA Kit Antibody 96 Tests 703 € acr human
AR51873PU-N anti-MICA (24-297, His-tag) Antibody 0,25 mg 1413 € acr human
AR51873PU-S anti-MICA (24-297, His-tag) Antibody 50 Вµg 587 € acr human
AM26571AF-N anti-MICA Antibody 0,1 mg 514 € acr human
AM31271AF-N anti-MICA Antibody 0,2 mg 442 € acr human
AM33130PU-N anti-MICA Antibody 2ml (200T) 413 € acr human
AP07325PU-N anti-MICA Antibody 50 Вµg 732 € acr human
GENTAUR-58be11128d24c Anti- MICA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be1112dda3b Anti- MICA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be40cd1357c Anti- MICA Antibody 100ug 393 € MBS Polyclonals human
abx215421 Anti-MICA Antibody inquire 50 € abbex human
abx225291 Anti-MICA Antibody 200 μl 514 € abbex human
AP30561CP-N anti-MICA Control Peptide Antibody 50 Вµg 282 € acr human
AM01181BT-N anti-MICA (+ MICB) Antibody 0,1 mg 674 € acr human
AM01181FC-N anti-MICA (+ MICB) Antibody 0,1 mg 645 € acr human
AM01181FC-T anti-MICA (+ MICB) Antibody 25 Вµg 326 € acr human
AM01181LE-N anti-MICA (+ MICB) Antibody 0,5 mg 877 € acr human
AM01181PU-N anti-MICA (+ MICB) Antibody 0,2 mg 761 € acr human
AM01181PU-T anti-MICA (+ MICB) Antibody 25 Вµg 311 € acr human
AM26693AF-N anti-MICA + MICB Antibody 0,1 mg 514 € acr human
AM26694AF-N anti-MICA + MICB Antibody 0,1 mg 514 € acr human
MBS621324 MHC Class 1 Chain-related Gene A (MHC Class I Polypeptide-related Sequence A, MICA, MIC-A, PERB11.1) Antibody 100ug 558 € MBS Polyclonals_1 human
F51246-0.08ML MICA Antibody 0.08 ml 199 € NJS poly human
F51246-0.4ML MICA Antibody 0.4 ml 406 € NJS poly human
GWB-864CC7 MICA antibody 1 vial 411 € genways human
GWB-MP766A MICA antibody 1 vial 521 € genways human
R32255 MICA Antibody 0.1mg 406 € NJS poly human
bs-0832R MICA Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human