| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MICA |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MICA antibody should be determined by the researcher |
| Intented use: |
This MICA antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q29983 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing of this gene results in multiple transcript variants, And the protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, It is a ligand for the NKG2-D type II integral membrane protein receptor, The protein product is expressed on the cell surface, Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma, This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A |
| Immunogen: |
Amino acids QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK of human MICA were used as the immunogen for the MICA antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MICA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MICA |
| Short name: |
MICA Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Major histocompabitility complex class I polypeptide-related sequence A (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
MICA and IDBG-77578 and ENSG00000204520 and 100507436, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006955 and immune response and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0045087 and innate immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, MHC class I polypeptide-related sequence A |
| Identity: |
7090 |
| Gene: |
MICA |
More about : MICA |
| Long gene name: |
MHC class I polypeptide-related sequence A |
| Synonyms: |
PERB11, 1 |
| Locus: |
6p21, 33 |
| Discovery year: |
1994-05-16 |
| GenBank acession: |
L14848 |
| Entrez gene record: |
100507436 |
| Pubmed identfication: |
8022771 |
| RefSeq identity: |
NM_001177519 |
| Classification: |
C1-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031073 |
| Locus Specific Databases: |
IMGT/HLA Database |