| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RBBP4 / RbAp48 / NURF55 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the RBBP4 antibody should be determined by the researcher |
| Intented use: |
This RBBP4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q09028 |
| Purity: |
Antigen affinity |
| Description: |
And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation, It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation, It is present in protein complexes involved in histone acetylation and chromatin assembly, This encoded protein is also part of co-repressor complexes, This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins, This protein also seems to be involved in transcriptional repression of E2F-responsive genes, Three transcript variants encoding different isoforms have been found for this gene, or NURF55) is a protein that in humans is encoded by the RBBP4 gene, which is an integral component of transcriptional silencing, Retinoblastoma binding protein 4 (also known as RbAp48 |
| Immunogen: |
Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RBBP4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RBBP4 / RbAp48 / NURF55 |
| Short name: |
RBBP4 Antibody / RbAp48 / NURF55 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
RBBP4 (Antibody to) / RbAp48 / NURF55 |
| Alternative technique: |
antibodies |
| Identity: |
9887 |
| Gene: |
RBBP4 |
More about : RBBP4 |
| Long gene name: |
RB binding protein 4, chromatin remodeling factor |
| Synonyms gene name: |
retinoblastoma-binding protein 4 retinoblastoma binding protein 4 |
| Synonyms: |
RbAp48 NURF55 lin-53 |
| Locus: |
1p35, 1 |
| Discovery year: |
1995-05-05 |
| GenBank acession: |
BC053904 |
| Entrez gene record: |
5928 |
| Pubmed identfication: |
8350924 14609955 17531812 |
| RefSeq identity: |
NM_005610 |
| Classification: |
NuRD complex Polycomb repressive complex 2 EMSY complex SIN3 histone deacetylase complex WD repeat domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000007998 |