RBBP4 Antibody / RbAp48 / NURF55

Contact us
Catalog number: R32202
Price: 406 €
Supplier: NJS poly
Product name: RBBP4 Antibody / RbAp48 / NURF55
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RBBP4 / RbAp48 / NURF55
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the RBBP4 antibody should be determined by the researcher
Intented use: This RBBP4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q09028
Purity: Antigen affinity
Description: And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation, It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation, It is present in protein complexes involved in histone acetylation and chromatin assembly, This encoded protein is also part of co-repressor complexes, This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins, This protein also seems to be involved in transcriptional repression of E2F-responsive genes, Three transcript variants encoding different isoforms have been found for this gene, or NURF55) is a protein that in humans is encoded by the RBBP4 gene, which is an integral component of transcriptional silencing, Retinoblastoma binding protein 4 (also known as RbAp48
Immunogen: Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RBBP4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RBBP4 / RbAp48 / NURF55
Short name: RBBP4 Antibody / RbAp48 / NURF55
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: RBBP4 (Antibody to) / RbAp48 / NURF55
Alternative technique: antibodies
Identity: 9887
Gene: RBBP4 | More about : RBBP4
Long gene name: RB binding protein 4, chromatin remodeling factor
Synonyms gene name: retinoblastoma-binding protein 4 retinoblastoma binding protein 4
Synonyms: RbAp48 NURF55 lin-53
Locus: 1p35, 1
Discovery year: 1995-05-05
GenBank acession: BC053904
Entrez gene record: 5928
Pubmed identfication: 8350924 14609955 17531812
RefSeq identity: NM_005610
Classification: NuRD complex Polycomb repressive complex 2 EMSY complex SIN3 histone deacetylase complex WD repeat domain containing
Havana BLAST/BLAT: OTTHUMG00000007998

Related Products :