SP2 Antibody

Contact us
Catalog number: R32182
Price: 1271 €
Supplier: MBS Recombinant Proteins
Product name: SP2 Antibody
Quantity: 1000ug
Other quantities: 1 vial 521€ 100ug 370€ 100ul 304€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SP2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the SP2 antibody should be determined by the researcher
Intented use: This SP2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q02086
Purity: Antigen affinity
Description: It localizes primarily within subnuclear foci associated with the nuclear matrix, Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs, This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors, This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and can activate or in some cases repress expression from different promoters, and its DNA sequence specificity differs from the other Sp proteins, Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene
Immunogen: Amino acids QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ of human SP2 were used as the immunogen for the SP2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SP2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SP2
Short name: SP2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SP2 (Antibody to)
Alternative technique: antibodies
Identity: 11207
Gene: SP2 | More about : SP2
Long gene name: Sp2 transcription factor
Synonyms: KIAA0048
Locus: 17q21, 32
Discovery year: 1993-02-10
Entrez gene record: 6668
Pubmed identfication: 1341900 9730617
RefSeq identity: NM_003110
Classification: Sp transcription factors Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000150196

Related Products :

GENTAUR-58ba492ad6bff Beta vulgaris Acidic endochitinase SP2 (SP2) 100ug 1768 € MBS Recombinant Proteins human
GENTAUR-58ba492b90a83 Beta vulgaris Acidic endochitinase SP2 (SP2) 1000ug 1768 € MBS Recombinant Proteins human
GENTAUR-58ba492c31e39 Beta vulgaris Acidic endochitinase SP2 (SP2) 100ug 2282 € MBS Recombinant Proteins human
GENTAUR-58ba492d6a054 Beta vulgaris Acidic endochitinase SP2 (SP2) 1000ug 2282 € MBS Recombinant Proteins human
A02S0203 anti-SP2 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AP06709PU-N anti-SP2 Antibody 0,1 mg 558 € acr human
C10844-1 anti-SP2 Antibody 50 Вµg 347 € acr human
C10844-2 anti-SP2 Antibody 0,1 mg 500 € acr human
abx218725 Anti-SP2 Antibody 200 μg 369 € abbex human
GWB-ASD597 Human SP2 Antibody bulk Ask price € genways bulk human
MAS013b Sheep RBC, Clone: Sp2/HL, Mouse Monoclonal antibody-; flow/IA 5 ml Ask price € accurate-monoclonals mouse
MAS013p Sheep RBC, Clone: Sp2/HL, Mouse Monoclonal antibody-; flow/IA 0.5 mg Ask price € accurate-monoclonals mouse
GWB-ML566H SP2 antibody 1 vial 521 € genways human
GWB-ML567I SP2 antibody 1 vial 521 € genways human
GWB-MM712A SP2 antibody 1 vial 521 € genways human
MBS415639 Sp2 Antibody 100ul 304 € MBS Polyclonals_1 human
MBS851141 Sp2 Antibody 100ug 370 € MBS Polyclonals_1 human
R32182 SP2 Antibody 0.1mg 406 € NJS poly human
OBT1726 Spectrin (alpha & beta), 240kD & 220kD, Clone: SB-SP2, Mouse Monoclonal antibody-Human, Chicken; IF/IH 100 ul Ask price € accurate-monoclonals chicken
BYA6591-1 Spectrin (alpha & beta), Clone: SB-SP2, Mouse Monoclonal antibody- 500ul 777 € accurate-monoclonals mouse
GENTAUR-58be167fda9a6 Anti-Human Progesterone Receptor MAb (Clone SP2) 100ul 387 € MBS mono human
GENTAUR-58be1694cdf9f Anti-Human Progesterone Receptor MAb (Clone SP2) 7 ml (RTU) 459 € MBS mono human
GENTAUR-58be1699b837c Anti-Human Progesterone Receptor MAb (Clone SP2) 500ul 757 € MBS mono human
GENTAUR-58be16dcec9a3 Anti-Human Progesterone Receptor MAb (Clone SP2) 1 mililiter 1144 € MBS mono human
abx266460 Anti-SP2 10 mg 485 € abbex human
abx163813 Anti-SP2 Peptide 1 mg 354 € abbex human
abx934752 Anti-SP2 siRNA inquire 50 € abbex human
abx934753 Anti-SP2 siRNA 15 nmol 528 € abbex human
GENTAUR-58ba4b793e79c Macrozoarces americanus Ice-structuring protein SP2 (HPLC 1) 100ug 1271 € MBS Recombinant Proteins human
GENTAUR-58ba4b79a96a6 Macrozoarces americanus Ice-structuring protein SP2 (HPLC 1) 1000ug 1271 € MBS Recombinant Proteins human