| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SP2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the SP2 antibody should be determined by the researcher |
| Intented use: |
This SP2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q02086 |
| Purity: |
Antigen affinity |
| Description: |
It localizes primarily within subnuclear foci associated with the nuclear matrix, Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs, This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors, This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and can activate or in some cases repress expression from different promoters, and its DNA sequence specificity differs from the other Sp proteins, Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene |
| Immunogen: |
Amino acids QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ of human SP2 were used as the immunogen for the SP2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SP2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SP2 |
| Short name: |
SP2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SP2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
11207 |
| Gene: |
SP2 |
More about : SP2 |
| Long gene name: |
Sp2 transcription factor |
| Synonyms: |
KIAA0048 |
| Locus: |
17q21, 32 |
| Discovery year: |
1993-02-10 |
| Entrez gene record: |
6668 |
| Pubmed identfication: |
1341900 9730617 |
| RefSeq identity: |
NM_003110 |
| Classification: |
Sp transcription factors Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000150196 |