EWS Antibody / EWSR1

Contact us
Catalog number: R32181
Price: 406 €
Supplier: NJS poly
Product name: EWS Antibody / EWSR1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: EWS / EWSR1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the EWSR1 antibody should be determined by the researcher
Intented use: This EWSR1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q01844
Purity: Antigen affinity
Description: Alternative splicing of this gene results in multiple transcript variants, Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis, Mutations in this gene, Related pseudogenes have been identified on chromosomes 1 and 14, The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain, These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein, and RNA processing and transport, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors, cell signaling, including gene expression, specifically a t(11, 22)(q24, This gene encodes a multifunctional protein that is involved in various cellular processes, q12) translocation
Immunogen: Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the EWSR1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: EWS / EWSR1
Short name: EWS Antibody / EWSR1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: EWS (Antibody to) / EWSR1
Alternative technique: antibodies
Identity: 3508
Gene: EWSR1 | More about : EWSR1
Long gene name: EWS RNA binding protein 1
Synonyms gene name: Ewing sarcoma breakpoint region 1
Synonyms: EWS
Locus: 22q12, 2
Discovery year: 1992-11-27
Entrez gene record: 2130
Pubmed identfication: 1522903
RefSeq identity: NM_005243
Classification: Zinc fingers RANBP2-type RNA binding motif containing
Havana BLAST/BLAT: OTTHUMG00000151107

Related Products :