| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HSD11B2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the HSD11B2 antibody should be determined by the researcher |
| Intented use: |
This HSD11B2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P80365 |
| Purity: |
Antigen affinity |
| Description: |
In aldosterone-selective epithelial tissues such as the kidney, In tissues that do not express the mineralocorticoid receptor, Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension, The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities, The type II isozyme, There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone, also known as 11-&, encoded by this gene, has only 11-beta-dehydrogenase activity, is an enzyme that in humans is encoded by the HSD11B2 gene, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development, such as the placenta and testis, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor, #946, #946, -dehydrogenase isozyme 2, -hydroxysteroid dehydrogenase 2, Corticosteroid 11-& |
| Immunogen: |
Amino acids EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH of human HSD11B2 were used as the immunogen for the HSD11B2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSD11B2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HSD11B2 |
| Short name: |
HSD11B2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HSD11B2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
5209 |
| Gene: |
HSD11B2 |
More about : HSD11B2 |
| Long gene name: |
hydroxysteroid 11-beta dehydrogenase 2 |
| Synonyms gene name: |
hydroxysteroid (11-beta) dehydrogenase 2 |
| Synonyms: |
SDR9C3 |
| Synonyms name: |
member 3 , short chain dehydrogenase/reductase family 9C |
| Locus: |
16q22, 1 |
| Discovery year: |
1994-11-18 |
| GenBank acession: |
U14631 |
| Entrez gene record: |
3291 |
| Pubmed identfication: |
7859916 8611140 19027726 |
| RefSeq identity: |
NM_000196 |
| Classification: |
Short chain dehydrogenase/reductase superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000137507 |