RBX1 Antibody / ROC1

Contact us
Catalog number: R32161
Price: 406 €
Supplier: NJS poly
Product name: RBX1 Antibody / ROC1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RBX1 / ROC1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the RBX1 antibody should be determined by the researcher
Intented use: This RBX1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P62877
Purity: Antigen affinity
Description: Conclusively, E1, ROC1 is recruited by cullin-1 to form a quaternary SCF (HOS)-ROC1 holoenzyme (with SKP1 and the BTRCP homolog HOS), ROC1 plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization, SCF (HOS)-ROC1 binds IKK-beta-phosphorylated I-kappa-B-alpha and catalyzes its ubiquitination in the presence of ubiquitin, This gene is mapped to chromosome 22q13, also known as ROC1, and CDC34, is a protein that in humans is encoded by the RBX1 gene, 2 based on an alignment of the RBX1 sequence with the genomic sequence, RING-box protein 1
Immunogen: Amino acids NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH of human ROC1/RBX1 were used as the immunogen for the RBX1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RBX1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RBX1 / ROC1
Short name: RBX1 Antibody / ROC1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: RBX1 (Antibody to) / ROC1
Alternative technique: antibodies
Identity: 9928
Gene: RBX1 | More about : RBX1
Long gene name: ring-box 1
Synonyms gene name: E3 ubiquitin protein ligase , ring-box 1 ring-box 1
Synonyms: ROC1 RNF75 BA554C12, 1
Synonyms name: regulator of cullins 1
Locus: 22q13, 2
Discovery year: 1999-10-29
GenBank acession: AF140598
Entrez gene record: 9978
Pubmed identfication: 10213691 10230407
RefSeq identity: NM_014248
Classification: Ring finger proteins SCF complex
Havana BLAST/BLAT: OTTHUMG00000151298

Related Products :