| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RBX1 / ROC1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the RBX1 antibody should be determined by the researcher |
| Intented use: |
This RBX1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P62877 |
| Purity: |
Antigen affinity |
| Description: |
Conclusively, E1, ROC1 is recruited by cullin-1 to form a quaternary SCF (HOS)-ROC1 holoenzyme (with SKP1 and the BTRCP homolog HOS), ROC1 plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization, SCF (HOS)-ROC1 binds IKK-beta-phosphorylated I-kappa-B-alpha and catalyzes its ubiquitination in the presence of ubiquitin, This gene is mapped to chromosome 22q13, also known as ROC1, and CDC34, is a protein that in humans is encoded by the RBX1 gene, 2 based on an alignment of the RBX1 sequence with the genomic sequence, RING-box protein 1 |
| Immunogen: |
Amino acids NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH of human ROC1/RBX1 were used as the immunogen for the RBX1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RBX1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RBX1 / ROC1 |
| Short name: |
RBX1 Antibody / ROC1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
RBX1 (Antibody to) / ROC1 |
| Alternative technique: |
antibodies |
| Identity: |
9928 |
| Gene: |
RBX1 |
More about : RBX1 |
| Long gene name: |
ring-box 1 |
| Synonyms gene name: |
E3 ubiquitin protein ligase , ring-box 1 ring-box 1 |
| Synonyms: |
ROC1 RNF75 BA554C12, 1 |
| Synonyms name: |
regulator of cullins 1 |
| Locus: |
22q13, 2 |
| Discovery year: |
1999-10-29 |
| GenBank acession: |
AF140598 |
| Entrez gene record: |
9978 |
| Pubmed identfication: |
10213691 10230407 |
| RefSeq identity: |
NM_014248 |
| Classification: |
Ring finger proteins SCF complex |
| Havana BLAST/BLAT: |
OTTHUMG00000151298 |