Lysozyme Antibody / LYZ

Contact us
Catalog number: R32157
Price: 406 €
Supplier: NJS poly
Product name: Lysozyme Antibody / LYZ
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Lysozyme / LYZ
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Lysozyme antibody should be determined by the researcher
Intented use: This Lysozyme antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P61626
Purity: Antigen affinity
Description: Lysozyme is one of the antimicrobial agents found in human milk, Missense mutations in this gene have been identified in heritable renal amyloidosis, The protein has antibacterial activity against a number of bacterial species, This gene encodes human lysozyme, and is also present in spleen, and tears, kidney, lung, plasma, saliva, the lysozyme enzyme is encoded by the LYZ gene, white blood cells, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine), In humans
Immunogen: Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Lysozyme antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Lysozyme / LYZ
Short name: Lysozyme Antibody / LYZ
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Lysozyme (Antibody to) / LYZ
Alternative technique: antibodies
Identity: 6740
Gene: LYZ | More about : LYZ
Long gene name: lysozyme
Synonyms gene name: lysozyme (renal amyloidosis)
Synonyms name: renal amyloidosis
Locus: 12q15
Discovery year: 1989-05-25
GenBank acession: X14008
Entrez gene record: 4069
Pubmed identfication: 8464497 2546758
RefSeq identity: NM_000239
Classification: Lysozymes, c-type
Havana BLAST/BLAT: OTTHUMG00000169342
Locus Specific Databases: LRG_768

Related Products :