| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Lysozyme / LYZ |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Lysozyme antibody should be determined by the researcher |
| Intented use: |
This Lysozyme antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P61626 |
| Purity: |
Antigen affinity |
| Description: |
Lysozyme is one of the antimicrobial agents found in human milk, Missense mutations in this gene have been identified in heritable renal amyloidosis, The protein has antibacterial activity against a number of bacterial species, This gene encodes human lysozyme, and is also present in spleen, and tears, kidney, lung, plasma, saliva, the lysozyme enzyme is encoded by the LYZ gene, white blood cells, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine), In humans |
| Immunogen: |
Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Lysozyme antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Lysozyme / LYZ |
| Short name: |
Lysozyme Antibody / LYZ |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Lysozyme (Antibody to) / LYZ |
| Alternative technique: |
antibodies |
| Identity: |
6740 |
| Gene: |
LYZ |
More about : LYZ |
| Long gene name: |
lysozyme |
| Synonyms gene name: |
lysozyme (renal amyloidosis) |
| Synonyms name: |
renal amyloidosis |
| Locus: |
12q15 |
| Discovery year: |
1989-05-25 |
| GenBank acession: |
X14008 |
| Entrez gene record: |
4069 |
| Pubmed identfication: |
8464497 2546758 |
| RefSeq identity: |
NM_000239 |
| Classification: |
Lysozymes, c-type |
| Havana BLAST/BLAT: |
OTTHUMG00000169342 |
| Locus Specific Databases: |
LRG_768 |