| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HSPA2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the HSPA2 antibody should be determined by the researcher |
| Intented use: |
This HSPA2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P54652 |
| Purity: |
Antigen affinity |
| Description: |
2, 3 or HSP70-3, 70-KD, 70-KD, Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, HEAT-SHOCK PROTEIN, HSP70-2, HSPA2 has less amino acid homology to the other members of the human HSP70 gene family, HSPA2 is constitutively expressed in most tissues, HSPA2 may be critical to sperm maturation through its role as a protein chaperone, Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm, The HSPA2 gene is located on chromosome 14q22-q24, with 91, with very high levels in testis and skeletal muscle, 2% in the corresponding amino acid sequence, 7% identity in the nucleotide coding sequence and 98, HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN |
| Immunogen: |
Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK of human HSPA2 were used as the immunogen for the HSPA2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSPA2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HSPA2 |
| Short name: |
HSPA2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HSPA2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
5235 |
| Gene: |
HSPA2 |
More about : HSPA2 |
| Long gene name: |
heat shock protein family A (Hsp70) member 2 |
| Synonyms gene name: |
heat shock 70kD protein 2 heat shock 70kDa protein 2 |
| Locus: |
14q23, 3 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
L26336 BC001752 |
| Entrez gene record: |
3306 |
| Classification: |
Heat shock 70kDa proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000141311 |