HSPA2 Antibody

Contact us
Catalog number: R32139
Price: 322 €
Supplier: ABM lentivectors
Product name: HSPA2 Antibody
Quantity: 1.0 µg DNA
Other quantities: 0.1mg 389€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HSPA2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the HSPA2 antibody should be determined by the researcher
Intented use: This HSPA2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P54652
Purity: Antigen affinity
Description: 2, 3 or HSP70-3, 70-KD, 70-KD, Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, HEAT-SHOCK PROTEIN, HSP70-2, HSPA2 has less amino acid homology to the other members of the human HSP70 gene family, HSPA2 is constitutively expressed in most tissues, HSPA2 may be critical to sperm maturation through its role as a protein chaperone, Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm, The HSPA2 gene is located on chromosome 14q22-q24, with 91, with very high levels in testis and skeletal muscle, 2% in the corresponding amino acid sequence, 7% identity in the nucleotide coding sequence and 98, HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN
Immunogen: Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK of human HSPA2 were used as the immunogen for the HSPA2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSPA2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HSPA2
Short name: HSPA2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: HSPA2 (Antibody to)
Alternative technique: antibodies
Identity: 5235
Gene: HSPA2 | More about : HSPA2
Long gene name: heat shock protein family A (Hsp70) member 2
Synonyms gene name: heat shock 70kD protein 2 heat shock 70kDa protein 2
Locus: 14q23, 3
Discovery year: 2001-06-22
GenBank acession: L26336 BC001752
Entrez gene record: 3306
Classification: Heat shock 70kDa proteins
Havana BLAST/BLAT: OTTHUMG00000141311

Related Products :

GENTAUR-58bdc64d2acce Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc64d828bc Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc82371cd9 Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc8d8de3f8 Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdcfb4560c7 Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcfb4cf6de Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd504a9d75 Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd58c20d60 Anti- Heat Shock 70kDa Protein 2 (HSPA2) Antibody 100ug 564 € MBS Polyclonals human
BB-PA1814 anti-HSPA2 Antibody 0,1 mg 471 € acr human
GENTAUR-58be0ef2b99fa Anti- HSPA2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0ef32a1d8 Anti- HSPA2 Antibody 0.06 ml 265 € MBS Polyclonals human
abx145244 Anti-HSPA2 Antibody 100 μg 369 € abbex human
abx216066 Anti-HSPA2 Antibody inquire 50 € abbex human
abx225223 Anti-HSPA2 Antibody 200 μl 514 € abbex human
GWB-MT816F HSPA2 antibody 1 vial 521 € genways human
R30912 HSPA2 Antibody 0.1mg 389 € NJS poly human
R32139 HSPA2 Antibody 0.1mg 406 € NJS poly human
BIN-003306-M04 HSPA2 Antibody (M04), clone 3A11-1A2 0.1mg 495 € Zyagen human
BIN-003306-M06 HSPA2 Antibody (M06), clone S51 0.1mg 495 € Zyagen human
YSRTMCA4049Z HSPA2, Mouse Monoclonal antibody-; Clone: 3H7 0.1 mg Ask price € accurate-monoclonals mouse
abx902564 Anti-HSPA2 siRNA 30 nmol 717 € abbex human
abx919973 Anti-HSPA2 siRNA 15 nmol 528 € abbex human
abx919974 Anti-HSPA2 siRNA 15 nmol 528 € abbex human
abx574014 Anti-Human Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit inquire 50 € abbex human
abx151864 Anti-Human HSPA2 ELISA Kit 96 tests 934 € abbex human
EKU04659 Heat Shock 70kDa Protein 2 (HSPA2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
LV184966 HSPA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV184967 HSPA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV184968 HSPA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV184969 HSPA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human